Details for Arabidopsis Locus AT1G77310

Position : Chr1 ( 5`- 29051505 .. 29056339 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77310

Protein [Map View]
MEDEPKLPTDDGPTFNESCKISSEILTAGDRKLLKVELLKEETTLVSWKKLMDEASKENGGLFVSAPERLLNANPNLEFR
LAPGAQTENEMVNQPHPNRLNSVIAKIERLYMGKDGSDGEELDGAPDDDDYDTEDSFIDDAELDEYFEVDNSPIKHDGFF
VNRGKLERIEPSATSNQQQPKKRRRKESAKPCGDVVDVSRKRAKMAKTAGGKDQSASPGPSSKKISNDSKTVQDSFSPLK
AQNGNDSLVLENVKHTDKANHQPMNATSPKSKAAGSSGPLHPKCSSKSVHEQSNSPPGKSRPNVSAKSAVVRQQVNNGMP
DLDIATESKTSIQISKKSGSNGRPKYSTLEKAIRNLEKLVAESRPPAATENQDADISSQAVKRGLPGDVKLHLAKVARIA
YASQGEISGELINRLMGIVGHLIQIRSLKRNLKIMIDSIVTANREKDTRFQRIKSEITEMLKTQVPLVESQETNQEAGTS
DDFQDVGSLGKSPVKKFVMDVALEEKLCDLYDVFVEGMDEHSGSQIRKLYSDLAQLWPNSLVDNHEIRRAICREKERRRA
LEGNIGKEMDQTKITKKKQTQLVPKSEGITYPDKTSGVEVKASVVLTATTTSLVDCQPAADSSFERSKQQHEKLKRTSSL
SNPAAEGKKVRRKTEPALEETHLPAEKPLVLALKRQTHLKSKTHKQVQVHPQSKAHKQAQVHPKAKTQTPPDLNLPS*

DNA
ATGGAGGACGAACCAAAGCTCCCAACCGATGACGGTCCAACTTTCAACGAATCGTGTAAAATCTCGTCTGAGATATTGAC
CGCCGGTGATCGGAAATTACTTAAAGTTGAACTCCTCAAAGAGGAGACCACGCTCGTATCGTGGAAGAAGCTTATGGATG
AGGCTAGCAAAGAAAACGGCGGCTTGTTCGTTTCGGCTCCCGAACGGCTTCTTAATGCCAACCCTAACCTCGAGTTTCGC
CTTGCACCGGGGGCACAAACAGAGAATGAAATGGTGAATCAACCTCATCCTAATCGTCTTAACTCTGTTATAGCCAAGAT
TGAGAGACTTTATATGGGTAAAGACGGTAGTGATGGGGAAGAGTTAGACGGTGCTCCTGACGATGATGACTATGACACTG
AAGATTCATTTATCGATGATGCTGAATTGGATGAGTATTTTGAAGTTGATAATTCGCCAATTAAACATGATGGATTTTTT
GTCAATAGAGGAAAGTTAGAACGAATTGAACCTTCAGCTACATCGAACCAGCAGCAACCAAAGAAAAGGCGAAGGAAGGA
GTCAGCAAAACCTTGTGGCGATGTTGTTGATGTATCCAGAAAACGAGCCAAGATGGCTAAGACGGCTGGGGGAAAGGATC
AATCTGCTTCTCCTGGGCCCTCTTCGAAGAAAATTTCCAATGATTCAAAGACGGTGCAAGATTCGTTTTCCCCTTTGAAA
GCGCAAAATGGCAATGATTCCTTAGTTTTGGAAAATGTGAAGCATACTGATAAAGCGAATCACCAGCCAATGAATGCCAC
GAGTCCGAAGTCAAAGGCAGCTGGATCTTCTGGCCCCCTTCATCCGAAGTGCAGCAGCAAAAGTGTTCATGAACAATCTA
ATTCCCCTCCAGGAAAATCTCGGCCAAATGTTTCGGCAAAATCAGCAGTAGTTCGTCAGCAAGTTAACAATGGCATGCCT
GACCTGGACATTGCAACGGAAAGCAAAACATCTATTCAAATATCTAAAAAAAGCGGTTCAAATGGCCGGCCTAAATACTC
GACACTTGAGAAAGCCATCAGGAATTTGGAGAAGTTGGTCGCTGAATCAAGGCCTCCTGCTGCCACTGAGAATCAAGATG
CCGATATCTCTTCCCAAGCAGTGAAGAGGGGATTGCCAGGAGATGTAAAATTGCATCTTGCTAAAGTTGCTAGAATCGCG
TATGCGAGCCAAGGTGAAATATCAGGAGAGTTAATCAATCGTCTCATGGGCATTGTCGGTCATCTAATACAGATTAGATC
ACTTAAGAGGAACTTGAAAATCATGATTGATTCGATCGTCACTGCAAATCGAGAAAAAGATACTAGATTTCAGCGGATCA
AGAGTGAAATAACTGAGATGTTAAAAACACAAGTTCCACTTGTGGAATCCCAGGAAACAAATCAAGAAGCTGGAACATCA
GACGATTTTCAGGATGTTGGATCTCTTGGAAAGTCACCTGTGAAGAAGTTTGTCATGGATGTGGCGCTGGAGGAAAAATT
GTGTGATCTATATGACGTGTTTGTTGAGGGAATGGATGAACATTCAGGTTCACAAATCAGAAAGCTTTATTCAGATCTAG
CTCAACTGTGGCCCAATAGTTTAGTTGACAATCATGAGATCAGGCGTGCCATTTGCCGGGAAAAGGAAAGGCGGAGAGCA
TTGGAAGGAAACATTGGGAAGGAGATGGATCAAACGAAGATAACAAAGAAGAAACAGACACAATTGGTCCCTAAATCTGA
GGGTATTACTTATCCCGACAAGACTTCAGGTGTTGAAGTTAAAGCAAGTGTTGTCCTAACTGCAACCACCACGTCCTTAG
TGGACTGTCAACCTGCAGCAGACTCGTCCTTTGAAAGGTCAAAGCAGCAACATGAGAAATTAAAGCGAACTTCGAGCTTA
AGCAATCCTGCAGCAGAAGGAAAGAAAGTCAGAAGAAAGACAGAACCAGCTCTAGAAGAAACTCACCTGCCCGCAGAGAA
ACCCCTCGTTCTGGCCCTGAAGCGGCAGACACATCTAAAATCCAAGACACATAAACAGGTACAGGTACATCCACAGTCCA
AGGCACATAAACAGGCACAGGTACATCCAAAGGCCAAGACACAGACTCCTCCAGACCTGAACCTGCCAAGTTAG