Details for Arabidopsis Locus AT1G77250

Position : Chr1 ( 5`- 29020265 .. 29023474 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77250

Protein [Map View]
MFMEEATSNGKGTEHNQPNGLVESEALNNWSAGCGAMANSANASSRDSKKIQTYKRRKLGRSYSANKCSENDRFSMEGVS
HSESRESVSYERFSIRTHLTGELPKPPSPNKPSSESTNHETVTAGCQHVLSHVLASKEFASLNRLLSENLQGVKIDDFTS
RTLIDTRMKEGVYEGSPLLFSTDLQEVWQKMQDVGNDMAVLANSLLELSRTSYKEQLKQFYTGESKPCPNAENIRNDSVS
DICKLCGEKAEARDCLACDHCEDMYHVSCAQPGGKGMPTHSWYCLDCTSKGIGSPHENCVVCEKMKTQGMMKTDNRSVDT
STECKEDSNESEENSSCNMNHEVHHVEMSRDSELCRTCGTKVDSGGKYITCDHPFCPHKYYHIRCLTSRQIKLHGVRWYC
SSCLCRNCLTDKDDDKIVLCDGCDDAYHIYCMRPPCESVPNGEWFCTACKAAILKVQKARKAFEKKMETVQKQKGIKPKN
LQGKPQSKDNGELDQSVGGMDMLLNAADTLKDEEQMTFQSIK*

DNA
ATGTTCATGGAGGAGGCGACAAGTAATGGTAAAGGTACAGAGCATAATCAGCCAAATGGTTTGGTGGAAAGTGAAGCATT
GAATAATTGGAGTGCAGGATGTGGTGCTATGGCTAATTCTGCAAATGCTAGTTCCAGAGATAGTAAGAAGATACAAACAT
ATAAGCGGAGAAAACTTGGGAGATCTTATTCTGCTAATAAATGTTCGGAAAATGATAGATTTTCCATGGAAGGTGTTAGT
CACTCAGAAAGCCGGGAGTCTGTCTCTTATGAAAGGTTTAGCATAAGAACCCATCTTACTGGTGAACTCCCGAAGCCTCC
CAGTCCAAATAAACCATCAAGTGAATCCACCAATCATGAGACGGTGACAGCCGGTTGCCAGCATGTTCTGTCCCATGTTT
TAGCTTCAAAGGAGTTTGCATCCCTAAATAGGTTACTTTCCGAAAATCTTCAAGGGGTCAAGATTGATGATTTTACGAGC
AGAACTCTGATAGACACCAGGATGAAAGAGGGTGTTTATGAAGGTTCACCTCTGCTCTTTTCAACGGATCTCCAAGAGGT
CTGGCAAAAAATGCAGGATGTTGGTAATGATATGGCTGTTCTTGCTAATAGTCTCTTAGAGCTTTCAAGAACCTCCTATA
AGGAACAGTTGAAGCAGTTCTACACTGGGGAATCGAAGCCTTGTCCTAATGCAGAGAACATCAGAAATGACAGTGTTTCT
GACATTTGCAAGCTATGTGGAGAGAAGGCAGAGGCAAGAGACTGTTTAGCATGTGATCATTGTGAAGATATGTACCATGT
CTCGTGTGCACAACCTGGTGGGAAAGGGATGCCAACACACAGTTGGTATTGTCTAGACTGTACATCTAAGGGAATCGGAT
CACCTCATGAGAATTGTGTAGTGTGTGAAAAAATGAAAACCCAAGGGATGATGAAGACAGATAACAGATCTGTTGATACG
AGTACAGAATGCAAAGAGGATTCGAACGAATCTGAAGAGAATTCAAGCTGTAACATGAATCATGAGGTGCACCACGTAGA
GATGAGTAGAGATTCTGAACTCTGTAGGACCTGTGGAACAAAGGTGGATAGTGGCGGAAAGTATATAACATGTGATCACC
CTTTTTGCCCACACAAGTATTACCACATCAGGTGCTTGACTTCAAGGCAAATAAAACTACACGGTGTCCGTTGGTATTGC
TCGTCATGCTTATGCAGAAATTGCCTAACTGACAAGGATGATGATAAAATCGTCTTGTGTGATGGGTGTGATGATGCATA
TCACATCTATTGCATGCGACCTCCATGTGAATCGGTTCCAAATGGAGAATGGTTTTGCACAGCATGTAAAGCTGCAATTC
TTAAAGTCCAAAAAGCACGAAAGGCTTTTGAGAAGAAGATGGAGACGGTGCAGAAACAGAAAGGAATAAAACCCAAGAAT
CTCCAAGGCAAACCGCAAAGTAAAGACAATGGAGAATTGGATCAAAGCGTAGGAGGAATGGACATGCTTCTAAACGCAGC
TGACACACTGAAAGATGAAGAACAGATGACATTCCAATCCATCAAATGA