Details for Arabidopsis Locus AT1G77220

Position : Chr1 ( 5`- 29012717 .. 29015803 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77220

Protein [Map View]
MEWRGILCSLLFIVSVGESSSRFGIMWHPNLGVDSGQYLTWPILSASVFVVIAILLPMYLIFEHLASYNQPEEQKFLIGL
ILMVPVYAVESFLSLVNSEAAFNCEVIRDCYEAFALYCFERYLIACLDGEERTIEFMEQQTVITQSTPLLEGTCSYGVVE
HPFPMNCFVKDWSLGPQFYHAVKIGIVQYMILKMICALLAMILEAFGVYGEGKFAWNYGYPYLAVVLNFSQTWALYCLVQ
FYNVIKDKLAPIKPLAKFLTFKSIVFLTWWQGIIVAFLFSMGLVKGSLAKELKTRIQDYIICIEMGIAAVVHLYVFPAAP
YKRGERCVRNVAVMSDYASIDVPPDPEEVKDSERTTRTRYGRHDDREKRLNFPQSVRDVVLGSGEIIVDDMRFTVSHVVE
PVERGIAKINRTFHQISENVKRFEQQKKTTKDDSYVIPLNQWAKEFSDVHENLYDGGSVSDSGLGSTNRHHQSRVSGLWT
RMRR*

DNA
ATGGAGTGGAGGGGAATCCTCTGCTCGTTGCTTTTTATTGTTTCCGTGGGAGAGTCGTCAAGTAGATTTGGGATAATGTG
GCATCCTAATCTTGGTGTTGATTCTGGACAATACTTGACTTGGCCAATCTTAAGTGCTAGTGTATTCGTGGTTATTGCCA
TCCTCCTCCCCATGTATCTTATCTTTGAGCACTTAGCTTCTTATAATCAACCAGAGGAACAGAAGTTTCTTATTGGACTT
ATTCTGATGGTTCCTGTTTATGCCGTGGAATCGTTTTTGTCTTTGGTGAATTCAGAAGCAGCTTTCAACTGCGAGGTGAT
TAGAGATTGTTATGAAGCTTTTGCACTCTATTGTTTCGAGAGATATTTGATAGCTTGCCTAGATGGAGAAGAACGTACAA
TTGAATTCATGGAACAACAGACAGTTATCACCCAGAGTACTCCTCTTCTAGAAGGCACATGTTCTTATGGGGTTGTAGAG
CATCCCTTTCCAATGAACTGCTTCGTAAAAGATTGGAGTCTTGGTCCTCAGTTTTATCATGCTGTGAAAATTGGCATCGT
TCAATATATGATACTGAAAATGATTTGTGCTCTGTTAGCAATGATCCTCGAAGCCTTTGGGGTTTATGGAGAAGGGAAGT
TCGCATGGAATTATGGATATCCATATCTGGCTGTAGTGCTCAATTTCAGTCAAACATGGGCATTGTATTGCCTTGTACAG
TTCTATAATGTCATCAAAGATAAGCTAGCACCCATAAAACCACTGGCCAAGTTTCTAACATTTAAGTCTATTGTATTCCT
CACCTGGTGGCAAGGTATTATTGTTGCGTTCCTCTTCTCTATGGGACTCGTCAAAGGGTCTTTGGCTAAGGAACTGAAAA
CGCGAATACAAGACTACATCATCTGTATCGAAATGGGTATTGCTGCTGTTGTCCATCTCTATGTGTTTCCAGCAGCGCCT
TACAAGCGTGGAGAAAGATGTGTTCGTAATGTAGCAGTCATGTCAGATTATGCCTCTATAGATGTACCACCTGATCCAGA
AGAGGTTAAAGATAGTGAACGAACAACTAGAACGCGGTATGGTAGACATGACGATAGAGAGAAACGCTTGAATTTCCCAC
AAAGTGTCCGTGATGTTGTGCTTGGGAGTGGTGAAATCATTGTGGATGACATGAGATTCACAGTTTCACATGTGGTGGAA
CCGGTTGAAAGAGGAATAGCGAAAATAAACAGAACATTCCATCAGATATCTGAAAATGTGAAAAGATTTGAGCAGCAGAA
GAAAACAACAAAGGATGATTCATATGTGATACCACTGAATCAATGGGCGAAAGAATTCTCAGATGTTCATGAAAACCTCT
ATGATGGAGGGAGTGTGAGCGACAGCGGTTTGGGAAGCACAAATCGGCATCACCAGTCTAGAGTCTCGGGATTGTGGACT
AGAATGCGAAGGTAA