Details for Arabidopsis Locus AT1G77210

Position : Chr1 ( 5`- 29008939 .. 29012096 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77210

Protein [Map View]
MAGGALTDEGGLKRAHLYEHRITSYFIFACIVGSMGGSLFGYDLGVSGGVTSMDDFLKEFFPGIYKRKQMHLNETDYCKY
DNQILTLFTSSLYFAGLISTFGASYVTRIYGRRGSILVGSVSFFLGGVINAAAKNILMLILGRIFLGIGIGFGNQAVPLY
LSEMAPAKIRGTVNQLFQLTTCIGILVANLINYKTEQIHPWGWRLSLGLATVPAILMFLGGLVLPETPNSLVEQGKLEKA
KAVLIKVRGTNNIEAEFQDLVEASDAARAVKNPFRNLLARRNRPQLVIGAIGLPAFQQLTGMNSILFYAPVMFQSLGFGG
SASLISSTITNAALVVAAIMSMYSADKFGRRFLLLEASVEMFCYMVVVGVTLALKFGEGKELPKSLGLILVVLICLFVLA
YGRSWGPMGWLVPSELFPLETRSAGQSVVVCVNLFFTALIAQCFLVSLCHLKYGIFLLFAGLILGMGSFVYFLLPETKQV
PIEEVYLLWRQHWLWKKYVEDVDE*

DNA
ATGGCCGGTGGAGCTCTTACCGATGAAGGAGGCCTAAAGAGAGCTCATCTCTATGAACATCGGATCACTTCTTACTTCAT
CTTCGCTTGCATCGTCGGATCCATGGGAGGCTCTCTTTTCGGCTATGATCTTGGAGTCTCTGGTGGTGTTACATCAATGG
ACGATTTCTTGAAAGAGTTCTTCCCAGGGATCTACAAAAGAAAGCAAATGCATCTAAACGAAACAGATTACTGCAAATAC
GACAATCAAATCCTCACACTCTTCACTTCTTCTCTCTACTTCGCCGGTTTAATCTCAACTTTCGGAGCTTCTTACGTCAC
CAGAATCTACGGTAGGAGAGGAAGCATCCTCGTTGGCTCTGTCAGCTTCTTCCTCGGAGGAGTGATTAACGCTGCAGCCA
AAAACATCCTCATGTTAATCCTTGGTCGAATCTTCCTCGGCATAGGCATTGGATTCGGAAACCAGGCGGTTCCGCTATAC
CTCTCGGAGATGGCTCCAGCGAAGATTAGAGGAACTGTGAATCAGCTTTTCCAGCTAACAACTTGCATTGGAATTCTAGT
TGCTAATTTGATAAACTACAAAACAGAGCAAATCCATCCATGGGGATGGAGACTCTCTCTCGGTCTCGCCACCGTCCCAG
CTATACTCATGTTCCTCGGTGGACTCGTTTTGCCTGAAACACCCAATAGTCTTGTCGAGCAAGGGAAGCTCGAGAAGGCT
AAAGCCGTGCTGATCAAAGTACGTGGCACAAACAATATAGAAGCTGAGTTTCAGGATCTTGTCGAAGCCAGTGACGCTGC
TAGAGCCGTGAAGAATCCGTTTCGCAATCTTCTTGCTAGAAGAAACAGACCGCAGCTAGTGATTGGAGCCATTGGGCTTC
CTGCGTTTCAGCAACTAACCGGAATGAATTCGATCCTGTTTTATGCTCCGGTTATGTTTCAGAGCTTAGGGTTTGGTGGA
TCTGCGTCGCTTATCTCGTCTACCATTACAAATGCTGCGCTTGTTGTCGCGGCGATCATGTCTATGTATTCAGCTGATAA
ATTTGGAAGAAGGTTTCTTCTTCTTGAAGCTAGCGTGGAGATGTTCTGTTACATGGTTGTAGTAGGAGTAACACTAGCCT
TGAAGTTTGGGGAAGGTAAGGAGCTACCAAAATCGCTCGGTCTGATTCTTGTGGTCCTTATCTGTCTATTTGTATTGGCG
TATGGTCGATCTTGGGGTCCAATGGGATGGTTAGTTCCGAGCGAGCTTTTCCCTCTAGAGACTCGATCAGCCGGTCAGAG
CGTTGTGGTGTGCGTGAACCTTTTCTTCACGGCTCTAATCGCGCAGTGTTTCCTGGTGTCGCTGTGCCATCTCAAGTACG
GAATATTCCTTTTATTCGCCGGACTTATATTGGGGATGGGAAGCTTCGTTTACTTTCTGTTGCCGGAGACGAAACAGGTT
CCGATTGAAGAGGTTTATCTTCTTTGGAGACAGCATTGGTTATGGAAGAAATATGTCGAAGATGTTGATGAATAA