Details for Arabidopsis Locus AT1G77200

Position : Chr1 ( 5`- 29004357 .. 29005091 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77200

Protein [Map View]
MTESSIISVKQSSPVPEEEDHHHHQQDSHRTNTKKRVRSDPGYRGVRMRTWGKWVSEIREPRKKSRIWLGTFSTPEMAAR
AHDAAALTIKGTSAVLNFPELATYLPRPASSSPRDVQAAAAVAAAMDFSPSSSSLVVSDPTTVIAPAETQLSSSSYSTCT
SSSLSPSSEEAASTAEELSEIVELPSLETSYDESLSEFVYVDSAYPPSSPWYINNCYSFYYHSDENGISMAEPFDSSNFG
PLFP*

DNA
ATGACCGAGTCATCCATTATCTCCGTCAAACAATCGTCTCCGGTGCCGGAGGAGGAGGATCATCATCATCACCAACAAGA
CTCCCACCGAACCAACACCAAGAAACGTGTAAGATCCGACCCGGGTTACCGAGGCGTCCGGATGCGAACGTGGGGCAAAT
GGGTCTCCGAGATCCGAGAGCCTCGCAAGAAGAGCCGAATCTGGCTAGGCACTTTCTCCACACCGGAAATGGCGGCGCGT
GCACATGACGCAGCTGCTCTCACCATTAAAGGAACTTCCGCCGTCCTCAACTTCCCGGAGCTCGCCACTTACCTTCCCCG
TCCAGCTTCCTCCTCTCCACGCGACGTTCAAGCCGCAGCCGCCGTAGCGGCCGCCATGGACTTCTCCCCCTCCTCCTCCT
CTCTCGTAGTCTCCGATCCAACCACCGTCATCGCCCCAGCTGAGACGCAGTTGTCTTCCTCGAGCTATTCAACGTGTACG
TCATCGTCGTTGTCACCGTCAAGCGAAGAAGCTGCGTCGACGGCGGAAGAACTAAGCGAGATAGTGGAGTTACCGAGTCT
AGAGACGAGTTACGATGAGTCATTGAGCGAGTTTGTGTACGTTGACTCGGCGTATCCACCTAGTTCGCCTTGGTATATTA
ATAATTGTTATAGCTTTTATTACCACAGCGACGAAAATGGCATTTCGATGGCTGAACCTTTCGACTCTTCCAATTTTGGC
CCCCTTTTTCCTTAG