Details for Arabidopsis Locus AT1G77180

Position : Chr1 ( 5`- 28999608 .. 29002135 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77180

Protein [Map View]
MKSLNDLPAPKSTTTTYYDHSNDAWFKNRVTESETVKSSSIKFKVVPAYLNRQGLRPKNPEDFGDGGAFPEIHLPQYPLL
MGKNKSNKPGAKTLPVTVDAQGNVVFDAIVRQNENSRKIVYSQHKDIIPKFLKNEGDLGTVVDEEEELQKEIQETAEETK
AAIEKIVNVRLSAAQPSNIARQSGDSQYIKYKPSQQSSAFNSGAKERIIRMVEMPVDPLDPPKFKHKRVPRASGSPPVPV
MHSPPRPVTVKDQQDWKIPPCISNWKNPKGYTIPLDKRLAADGRGLQDVQINDNFAKLSEALYVAEQKAREAVSMRSKVQ
KEMVMKDKERKEQELRALAQKARSERTGAAMSMPVSSDRGRSESVDPRGDYDNYDQDRGREREREEPQETREEREKRIQR
EKIREERRRERERERRLDAKDAAMGKKSKITRDRDRDISEKVALGMASTGGKGGGEVMYDQRLFNQDKGMDSGFAADDQY
NLYDKGLFTAQPTLSTLYKPKKDNDEEMYGNADEQLDKIKNTERFKPDKAFTGASERVGSKRDRPVEFEKEEEQDPFGLE
KWVSDLKKGKKPLDKIGSGGTMRASGGGGSSSRDDDHGGSGRTKINFERSDRR*

DNA
ATGAAGTCTCTTAATGATCTTCCTGCGCCCAAATCAACCACTACCACGTATTATGATCATTCTAATGATGCTTGGTTCAA
AAACCGAGTCACTGAATCCGAGACGGTGAAATCCTCCAGTATCAAATTTAAAGTGGTGCCTGCTTACCTGAATCGTCAAG
GTTTACGTCCGAAGAATCCAGAGGATTTTGGCGATGGTGGTGCTTTCCCGGAGATTCATCTTCCTCAGTATCCTCTTCTT
ATGGGTAAGAATAAATCCAATAAGCCTGGAGCTAAGACTCTCCCTGTTACTGTCGATGCTCAGGGAAACGTGGTCTTTGA
CGCTATAGTGAGGCAGAATGAGAACTCGAGGAAGATTGTTTATTCTCAGCATAAGGATATTATTCCAAAGTTTCTGAAAA
ACGAGGGAGACTTGGGTACTGTTGTTGATGAAGAGGAGGAATTGCAGAAGGAGATTCAGGAGACTGCTGAAGAAACGAAA
GCTGCCATTGAGAAGATTGTGAATGTGAGACTGAGTGCAGCGCAGCCTAGTAATATAGCAAGGCAATCGGGAGATTCACA
GTACATTAAATATAAGCCATCCCAGCAATCTTCTGCCTTCAATTCTGGTGCTAAAGAGAGGATCATTAGGATGGTGGAGA
TGCCTGTAGATCCACTTGATCCACCAAAGTTCAAGCACAAGAGAGTCCCAAGGGCTTCTGGTTCTCCGCCTGTTCCGGTC
ATGCATTCACCGCCCAGGCCTGTTACCGTCAAGGACCAGCAAGACTGGAAAATCCCTCCTTGTATCTCCAATTGGAAGAA
TCCGAAAGGTTACACAATCCCTCTTGACAAACGTCTAGCTGCTGATGGAAGGGGCCTACAAGACGTTCAGATCAATGATA
ACTTTGCCAAGTTATCAGAGGCCCTCTATGTAGCTGAGCAGAAAGCTAGAGAGGCTGTTTCAATGCGTTCCAAGGTGCAA
AAAGAGATGGTGATGAAGGACAAGGAAAGGAAAGAGCAGGAATTGAGGGCTCTTGCCCAAAAAGCTCGCTCCGAAAGAAC
CGGTGCTGCTATGAGTATGCCTGTCTCATCTGACAGGGGTAGGAGTGAAAGTGTTGACCCAAGAGGTGATTATGACAACT
ATGACCAGGATAGAGGAAGGGAAAGAGAAAGGGAAGAGCCTCAAGAGACGAGGGAGGAGAGGGAAAAAAGGATTCAGAGA
GAAAAGATACGAGAAGAGCGTCGCAGGGAAAGAGAGAGGGAGAGAAGGTTGGATGCCAAAGATGCTGCCATGGGGAAGAA
GAGCAAGATCACCAGAGACAGAGACCGTGACATCAGTGAGAAAGTTGCTCTTGGAATGGCATCTACTGGAGGAAAAGGTG
GTGGTGAAGTTATGTATGATCAACGTCTGTTTAACCAAGACAAAGGAATGGACTCTGGTTTCGCTGCTGATGACCAATAC
AACTTATACGACAAAGGCTTGTTCACTGCACAACCAACTCTTTCGACTTTGTACAAGCCAAAGAAGGATAACGATGAAGA
AATGTATGGAAACGCTGATGAGCAGCTCGATAAGATCAAGAATACTGAGAGGTTTAAGCCTGACAAAGCTTTCACAGGGG
CTTCAGAGAGGGTGGGTAGTAAGAGAGACCGACCTGTTGAGTTTGAGAAGGAAGAGGAACAAGATCCTTTCGGTCTTGAG
AAGTGGGTTTCTGATTTAAAGAAGGGTAAGAAACCTTTGGACAAGATCGGGTCTGGTGGAACTATGAGAGCAAGTGGCGG
TGGTGGTAGCTCTTCAAGGGACGATGACCACGGCGGTTCTGGTCGAACCAAGATCAATTTCGAACGCAGTGACCGGCGTT
AA