Details for Arabidopsis Locus AT1G77150

Position : Chr1 ( 5`- 28992876 .. 28993170 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77150

Protein [Map View]
MMKSEFELEPGLSHYGCIVDLLSRDGQLKEANKVVKEMPMKPNVMVWGMWKDVERVRKLMKKKKVAKIPAYSYASTTI*

DNA
ATGATGAAGTCAGAGTTCGAACTAGAACCAGGATTATCGCATTACGGATGCATAGTTGATCTGTTGAGCCGTGACGGGCA
GCTTAAGGAGGCCAATAAAGTTGTTAAAGAGATGCCGATGAAGCCTAACGTGATGGTTTGGGGGATGTGGAAAGATGTTG
AGAGAGTTAGGAAGTTGATGAAGAAGAAGAAGGTTGCTAAGATTCCTGCCTATAGCTATGCTTCAACGACAATTTGA