Details for Arabidopsis Locus AT1G77145

Position : Chr1 ( 5`- 28989927 .. 28991346 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77145

Protein [Map View]
MGSLGEEDLEKLVLDYIESPITVSQHIESSTTALITLKEILRAKGEKEKEMEEKIWSFINGGRLSYEGDDEKRDVMNKIV
SKLRSEGYDASLSKTSWDSSFDHREGCRVFRCSRKYEYIDVMVKGDSNRDGVSKLKRVIIDLDFKTQFELARQTEAYKDM
TEMLPLVFVATEGRLRRVVSLVCGEMKKSMKKEGMSRPPWRTTRYMQSKWLPENRRRVSGCKKGSWSWSVFDDGSEGRGE
ARTWTVSGSGPKTKCCFPIF*

DNA
ATGGGAAGCTTGGGAGAAGAAGATTTAGAGAAGCTTGTGCTCGATTATATCGAGTCTCCGATCACCGTCTCCCAGCATAT
TGAGAGTTCTACAACGGCTCTTATCACTCTTAAGGAGATTCTTAGGGCAAAAGGAGAAAAAGAGAAGGAGATGGAAGAGA
AGATATGGTCGTTTATCAATGGAGGAAGGTTATCATATGAAGGAGACGATGAGAAGAGAGATGTGATGAACAAGATTGTC
TCTAAACTCAGATCTGAAGGCTATGATGCTTCTCTCTCCAAAACCTCATGGGACTCTTCTTTTGATCATCGTGAAGGGTG
TAGAGTGTTTAGGTGCTCGAGGAAGTATGAGTACATTGACGTCATGGTGAAGGGTGATAGCAACCGTGATGGCGTAAGCA
AGCTGAAACGTGTGATAATTGATCTTGACTTCAAAACTCAGTTTGAGCTAGCGAGACAGACAGAAGCTTACAAAGATATG
ACTGAGATGCTTCCATTAGTGTTTGTGGCGACAGAAGGGAGACTGAGAAGAGTTGTTTCGTTGGTTTGTGGTGAGATGAA
AAAGTCCATGAAGAAAGAAGGAATGTCTAGGCCTCCATGGAGGACTACGAGATACATGCAGTCCAAGTGGCTACCAGAGA
ATCGTCGAAGAGTCTCCGGTTGTAAGAAAGGTTCTTGGTCTTGGTCTGTGTTTGATGATGGTAGTGAAGGAAGAGGTGAA
GCTAGGACTTGGACAGTAAGTGGTAGTGGTCCGAAAACTAAGTGTTGTTTTCCTATTTTCTGA