Details for Arabidopsis Locus AT1G77122

Position : Chr1 ( 5`- 28977357 .. 28978743 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77122

Protein [Map View]
MDLLFCFRPNQTCRGISVLPAFSISNLSAVNRFRSTTSLRFGFPATPFRRTPNFTFKTHAKRKNKTSTFEPKPNKVEELI
IEEEEEEEEEEEIVLPEEIQENQDELLLDDEYDEDDDDDFEFDESEEELYAGDGGGGGGIKLAGTLWDKVALALAVKVCE
SFDGDLGIYAFKTLPNSTIQVRIERLTNKFGSPTMEDIEAFSTIYRAKLAEAELAKSIPDNISLEVSSPGVERVVRIPQD
LDRYKDRPMYVRYTNEDTETEGDGIFRLVSFDVEAKICIWGIADIRVNREKAGKGRPLSKKQREWRLETAFESLRLVRLH
SEC*

DNA
ATGGATTTGTTGTTCTGTTTCCGACCGAATCAGACTTGTCGGGGAATTTCAGTTTTGCCTGCTTTTAGCATAAGCAATCT
TTCCGCCGTCAATCGTTTCCGTTCGACGACGAGTCTTCGTTTTGGATTTCCGGCGACGCCGTTTCGTCGGACTCCAAACT
TTACCTTCAAAACTCACGCGAAGAGGAAGAATAAAACGAGTACTTTCGAACCGAAACCGAATAAAGTCGAAGAGTTGATC
ATTGAAGAAGAAGAAGAAGAAGAAGAAGAAGAGGAGATAGTTCTTCCCGAAGAGATTCAAGAGAATCAAGACGAGTTGCT
ACTGGATGATGAATATGACGAAGACGATGACGATGACTTTGAGTTCGATGAGAGCGAGGAGGAGCTCTATGCTGGAGATG
GTGGTGGTGGAGGAGGCATCAAACTTGCTGGAACATTATGGGACAAAGTAGCATTAGCATTAGCTGTGAAAGTTTGTGAG
TCTTTTGATGGTGATTTAGGCATTTATGCCTTCAAGACTCTGCCAAATTCAACCATACAAGTGAGAATCGAGCGGCTCAC
TAACAAGTTTGGTTCACCAACAATGGAAGACATTGAAGCATTTTCAACAATCTACCGAGCAAAATTGGCTGAAGCAGAAC
TCGCCAAGTCAATACCGGACAATATCTCTCTAGAGGTTTCATCTCCTGGTGTCGAAAGGGTAGTACGAATTCCGCAGGAT
CTTGATCGGTATAAGGATAGACCGATGTACGTGAGGTACACTAACGAGGACACTGAGACCGAAGGTGATGGTATTTTCAG
GCTGGTTTCTTTCGATGTGGAAGCTAAAATCTGCATTTGGGGCATAGCAGATATAAGAGTAAACCGAGAAAAGGCCGGCA
AAGGAAGACCTTTGAGCAAGAAGCAAAGAGAATGGCGACTCGAAACGGCTTTCGAGTCACTACGGTTAGTCCGTTTGCAT
TCTGAATGTTGA