Details for Arabidopsis Locus AT1G77110

Position : Chr1 ( 5`- 28970802 .. 28974603 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77110

Protein [Map View]
MITGNEFYTVMCAMAPLYFAMFVAYGSVKWCKIFTPAQCSGINRFVSVFAVPVLSFHFISQNNPYKMDTMFILADTLSKI
FVFVLLSLWAVFFKAGGLDWLITLFSIATLPNTLVMGIPLLQAMYGDYTQTLMVQLVVLQCIIWYTLLLFLFELRAARLL
IRAEFPGQAAGSIAKIQVDDDVISLDGMDPLRTETETDVNGRIRLRIRRSVSSVPDSVMSSSLCLTPRASNLSNAEIFSV
NTPNNRFFHGGGGSGTLQFYNGSNEIMFCNGDLGGFGFTRPGLGASPRRLSGYASSDAYSLQPTPRASNFNELDVNGNGT
PVWMKSPAAGRIYRQSSPKMMWESGQRHAAKDINGSVPEKEISFRDALKAAPQATAAGGGASMEEGAAGKDTTPVAAIGK
QEMPSAIVMMRLILTVVGRKLSRNPNTYSSLLGLVWSLISFKWNIPMPNIVDFSIKIISDAGLGMAMFSLGLFMALQPKM
IPCGAKKATMGMLIRFISGPLFMAGASLLVGLRGSRLHAAIVQAALPQGIVPFVFAREYNLHPDLLSTLVIFGMIVSLPV
TILYYVLLGL*

DNA
ATGATAACGGGAAACGAATTCTACACGGTGATGTGTGCCATGGCACCACTCTACTTCGCCATGTTCGTGGCTTATGGATC
GGTAAAGTGGTGCAAGATCTTCACGCCGGCGCAATGTTCCGGAATCAACCGTTTTGTCTCCGTTTTCGCCGTCCCAGTCC
TCTCTTTCCACTTCATCTCACAAAACAACCCTTACAAAATGGACACAATGTTCATCCTCGCCGACACTTTGTCCAAAATC
TTCGTCTTCGTTTTGCTCTCTCTATGGGCCGTTTTCTTCAAAGCCGGTGGTCTCGATTGGCTCATCACTCTATTCTCAAT
CGCTACTCTCCCTAACACTCTCGTTATGGGCATACCTTTGCTTCAGGCCATGTATGGAGATTACACTCAAACCCTCATGG
TCCAACTCGTTGTTCTTCAATGCATCATTTGGTATACTCTGCTACTATTCCTCTTTGAACTCCGAGCAGCGAGGTTGCTT
ATCCGAGCAGAGTTTCCGGGTCAAGCAGCCGGATCAATCGCCAAGATCCAAGTCGACGATGACGTCATTTCCTTAGACGG
CATGGATCCGCTCCGTACAGAAACTGAAACCGATGTTAACGGTCGGATCAGGCTCAGGATCCGACGGTCCGTATCATCCG
TACCTGATTCTGTTATGTCCTCCTCCTTGTGCTTAACCCCTAGAGCCTCTAATCTTTCTAACGCCGAGATTTTCTCCGTC
AACACTCCTAATAACCGTTTCTTCCACGGCGGAGGAGGAAGCGGTACCCTTCAGTTTTATAACGGTAGTAACGAGATCAT
GTTTTGTAACGGAGATTTAGGCGGGTTCGGATTTACTCGACCCGGATTAGGTGCAAGTCCTAGAAGGCTCTCGGGTTATG
CTTCCTCCGATGCTTACTCGTTGCAGCCAACACCACGTGCCTCGAACTTTAACGAGCTTGACGTTAACGGAAACGGTACG
CCGGTTTGGATGAAATCTCCTGCCGCCGGGAGAATATACCGGCAATCTTCGCCGAAGATGATGTGGGAGTCTGGGCAAAG
ACATGCAGCCAAAGATATCAATGGATCAGTGCCAGAGAAGGAGATTAGCTTCAGAGACGCACTTAAGGCTGCACCACAGG
CTACGGCAGCCGGTGGTGGTGCTTCCATGGAGGAAGGAGCCGCCGGAAAAGACACAACTCCGGTGGCTGCGATTGGCAAG
CAAGAAATGCCAAGTGCAATTGTAATGATGCGCCTCATACTAACAGTCGTGGGCCGCAAGCTTTCTCGAAACCCTAACAC
TTATTCCAGCCTCTTAGGTCTTGTCTGGTCACTTATATCCTTCAAATGGAATATACCGATGCCAAATATAGTGGATTTCT
CGATAAAGATCATTTCAGATGCAGGTCTTGGGATGGCTATGTTTAGTTTAGGCCTGTTTATGGCGCTGCAGCCAAAGATG
ATCCCTTGTGGGGCGAAAAAGGCAACAATGGGGATGTTGATCAGGTTCATCTCAGGTCCTCTTTTCATGGCTGGTGCTTC
CCTTCTTGTCGGATTAAGAGGTTCTAGGTTACATGCTGCTATCGTACAGGCTGCTCTACCGCAAGGGATAGTACCATTTG
TGTTTGCGAGGGAGTACAATTTGCATCCAGACCTACTCAGTACATTGGTTATCTTTGGGATGATAGTATCTTTACCAGTA
ACTATTTTGTACTACGTCCTCTTGGGCCTATGA