Details for Arabidopsis Locus AT1G77100

Position : Chr1 ( 5`- 28965772 .. 28967066 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77100

Protein [Map View]
MSRRIREDISIRLFDPKMITIALFLVLLYFHDQLGYSAAQLQFGFYSETCPSAESIVRDVVQQAVTNDPGKAAVLLRLQF
HDCFVEGCDGSILIKHGGNDDERFAAGNAGVAGFDVIDEAKSELERFCPGVVSCADIVALAARDAIAEAKGPFYEVPTGR
RDGLIANVDHAKNLPDVQDSINTLKSKFREKGLSDQDLVLLSAGAHTIGTTACFFVIPRLDAQDPTINPEFFQILRSKCP
QGGDVNVRIPLDWDSQFVFDNQIFQNIKNGRGVILSDSVLYQDNNMKKIIDSYLETNQSSKANFAADFTKAMIKMGAIGV
KIGAEGEIRRLCSATN*

DNA
ATGAGCCGTAGAATACGAGAAGATATATCAATTCGTTTGTTTGATCCCAAAATGATCACTATTGCATTATTTCTAGTTTT
GTTATATTTTCATGATCAATTAGGTTATTCAGCGGCACAACTTCAGTTTGGATTCTACTCGGAAACATGTCCATCAGCAG
AGTCAATCGTTCGTGATGTTGTTCAACAGGCGGTGACCAACGACCCAGGGAAGGCTGCTGTCTTACTCCGTCTCCAGTTC
CACGATTGCTTTGTCGAGGGTTGTGATGGGTCAATACTAATCAAGCATGGTGGGAACGATGACGAAAGGTTTGCTGCGGG
TAACGCGGGGGTGGCTGGTTTCGATGTTATAGACGAAGCCAAATCAGAGCTTGAACGTTTTTGTCCGGGCGTTGTGTCTT
GCGCTGACATCGTTGCTCTTGCTGCTAGAGACGCTATTGCTGAGGCAAAAGGACCATTTTATGAAGTTCCAACCGGTCGG
AGAGACGGTCTGATTGCAAATGTTGATCATGCTAAGAACTTGCCAGATGTTCAAGATTCCATAAATACTTTGAAATCAAA
ATTTAGAGAAAAAGGGCTTTCAGATCAAGATCTTGTACTTCTTAGTGCTGGTGCACATACTATTGGTACAACGGCTTGCT
TCTTTGTCATACCACGTTTAGATGCTCAAGATCCTACGATAAACCCGGAATTTTTTCAAATCCTGAGGTCAAAGTGTCCC
CAAGGCGGTGATGTTAATGTCAGGATTCCGTTGGACTGGGATAGCCAATTTGTGTTTGATAACCAAATCTTCCAAAACAT
CAAAAATGGCAGAGGTGTCATTCTATCGGACTCTGTTTTATACCAAGACAATAATATGAAGAAAATCATTGATTCATACT
TAGAAACTAATCAAAGTTCAAAGGCTAATTTTGCTGCGGATTTCACTAAAGCCATGATAAAGATGGGTGCTATCGGAGTG
AAAATCGGTGCTGAAGGAGAGATTAGACGTTTATGCAGTGCTACAAACTAG