Details for Arabidopsis Locus AT1G77090

Position : Chr1 ( 5`- 28960387 .. 28961922 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77090

Protein [Map View]
MMETALLRYCVNFSGHKKISAHQRSNSEIPKTSPGGCEDEWCARVLSRRSVMASGLVSSTTALAFPREGLAVVKQGLLAG
RVPGLSEPDEEGWRTYRRPDEKSGGHGVGWSPIIPYAFSVPQDWNEVPVSIADLGGTEIDLRFASPKEGRLSVIVAPVLR
FADNLGDDVKIENIGQPAKVINAFGPEVIGENVEGKVLSSNVAEHDGRLYYQFELEPPHVLITATAAGNRLYLFSVTGNG
LQWKRHYKDLKRIASSFRIV*

DNA
ATGATGGAAACAGCTCTGCTCCGGTACTGCGTCAACTTTTCCGGTCACAAGAAAATCTCTGCTCATCAAAGAAGTAATAG
TGAGATTCCGAAAACGAGTCCGGGAGGATGCGAAGACGAGTGGTGTGCTAGGGTTTTGAGTAGAAGATCGGTAATGGCGT
CAGGGTTGGTCTCCTCGACGACGGCTTTAGCATTTCCAAGGGAAGGATTGGCTGTCGTTAAACAAGGTCTTCTCGCTGGG
AGAGTTCCTGGTCTGTCCGAACCTGATGAAGAAGGTTGGAGAACATACCGTAGACCAGACGAGAAGTCAGGAGGGCATGG
TGTTGGTTGGAGTCCTATTATCCCTTACGCCTTTTCGGTTCCTCAAGATTGGAATGAGGTACCTGTATCGATCGCTGATC
TTGGTGGCACCGAGATTGACTTGAGATTTGCTAGTCCTAAAGAAGGCCGTTTGTCTGTTATTGTAGCTCCTGTTCTTAGA
TTTGCAGATAACCTCGGGGACGATGTTAAGATTGAAAATATTGGACAACCAGCGAAGGTGATTAACGCGTTTGGACCAGA
AGTTATTGGAGAAAACGTAGAAGGGAAGGTGTTAAGTTCCAATGTTGCAGAACACGATGGTAGACTCTATTACCAATTCG
AGCTAGAGCCGCCTCATGTACTGATAACTGCAACAGCTGCCGGAAACCGCCTTTACTTGTTCAGTGTCACCGGAAACGGT
CTTCAATGGAAGAGACACTACAAGGATCTGAAGAGGATAGCTAGTTCATTCCGCATTGTTTAG