Details for Arabidopsis Locus AT1G77060

Position : Chr1 ( 5`- 28951685 .. 28953509 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77060

Protein [Map View]
MSMLMAVKTTSLCCSSLNLTASPTFRRNPRAARLVNPTARIQTRFHRLIEEQGIVLMPGCYDALSAAIVQQTGFSAGFIS
GYALSASLLGKPDFGLLTPPEMAATARSVCASAPNIPIIADADTGGGNALNIQRTVKDLIAAGAAGCFLEDQAWPKKCGH
MRGKQVIPAEEHAAKIASARDAIGDSDFFLVARTDVRATSAKSGLEDAIARVNLYMEAGADASFVEAPRDDDELKEIGKR
TKGYRVCNMIEGGVTPLHTPDELKEMGFHLIVHPLTALYASTRALVDVLKTLKENGSTRDHLQKMATFEEFNSLVDLDSW
FELEARYSNLRNALGTTKS*

DNA
ATGTCGATGTTAATGGCTGTCAAAACAACTTCACTCTGTTGTAGCAGCTTAAACCTTACAGCTTCACCAACATTCCGACG
GAACCCACGCGCGGCGAGATTGGTGAATCCGACAGCGAGAATCCAAACACGTTTTCATCGCCTGATTGAAGAACAAGGCA
TTGTGCTTATGCCTGGATGCTACGATGCCTTATCCGCGGCTATTGTGCAGCAAACCGGATTCTCCGCTGGTTTTATATCC
GGTTACGCCTTATCCGCTTCTCTCCTGGGAAAACCCGATTTCGGTTTGCTAACACCACCGGAGATGGCTGCGACGGCAAG
GTCGGTGTGTGCGTCAGCTCCTAATATACCCATCATTGCAGATGCTGATACCGGTGGAGGAAATGCGCTAAACATTCAAA
GAACCGTAAAGGATTTGATTGCAGCTGGTGCTGCTGGTTGCTTCCTTGAGGACCAAGCATGGCCAAAGAAGTGTGGTCAT
ATGCGTGGTAAACAGGTGATACCAGCAGAAGAACATGCCGCAAAAATAGCATCAGCTCGAGATGCTATTGGAGACTCTGA
CTTCTTCCTTGTCGCAAGAACAGACGTGCGTGCTACTTCTGCAAAATCAGGGCTTGAAGACGCCATTGCACGTGTTAATC
TATACATGGAGGCAGGAGCTGATGCTTCCTTTGTAGAGGCACCAAGAGACGACGATGAGCTCAAGGAAATTGGAAAACGC
ACAAAAGGTTATAGAGTTTGCAACATGATTGAAGGAGGAGTCACACCATTACACACGCCTGATGAGCTTAAAGAAATGGG
ATTCCACTTGATAGTTCACCCCCTTACCGCACTCTATGCATCGACTCGAGCTCTGGTCGATGTTCTCAAGACTCTTAAAG
AAAACGGTAGCACTCGAGATCACTTGCAAAAGATGGCTACTTTTGAGGAATTCAATAGTTTGGTGGATTTAGATTCGTGG
TTTGAGCTTGAAGCTCGCTATTCAAACCTCAGAAACGCTCTTGGGACAACCAAATCATGA