Details for Arabidopsis Locus AT1G77020

Position : Chr1 ( 5`- 28944843 .. 28947031 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77020

Protein [Map View]
MVKETVYYDVLGVTPSASEEEIRKAYYIKARQVHPDKNQGDPLAAEKFQVLGEAYQVLSDPVHREAYDRTGKFSAPKETM
VDPTAVFALLFGSELFEDYIGHLAVASMASTQMASEIENSDQFQDKLKAVQKEREENLSRFLKDFLSQYVHGDKEGFISR
AESEAKRLSDAAFGADMLHTIGYVYTRQAAQELGKRALYLGVPFVAEWVRNKGHSWKSQISAAKGALQLLQLQEESNRRL
KKDGTSPANELESHIQTNKETLMGSLWKLNVVDIEVTLLHVCQMVFRENNLRKEELKSRAMALKILGKIFQQEKQSKNGT
TSRKEDEDSDDDDSSSDDDSSQPLSYRTPLLTQGIGRLFRCLCNPAFDVDDDEIVYKGK*

DNA
ATGGTGAAGGAAACAGTGTATTATGATGTTCTTGGTGTCACTCCCTCTGCTTCTGAGGAAGAGATTCGCAAGGCTTATTA
CATCAAGGCAAGACAAGTTCATCCTGACAAGAATCAAGGTGATCCTCTAGCTGCTGAAAAGTTTCAGGTTCTTGGTGAAG
CTTACCAGGTTCTAAGTGATCCTGTTCATCGTGAAGCGTATGATCGGACTGGAAAATTCTCAGCTCCCAAAGAAACAATG
GTTGATCCAACGGCTGTTTTCGCTCTTCTTTTCGGAAGTGAACTATTCGAGGATTATATCGGTCACTTGGCTGTTGCATC
AATGGCTTCCACTCAAATGGCTTCTGAAATCGAAAACTCTGATCAGTTTCAAGACAAACTAAAGGCTGTTCAGAAAGAAA
GAGAAGAAAACCTTTCAAGGTTTCTCAAAGATTTTCTGAGTCAATATGTCCACGGAGACAAAGAAGGATTCATAAGCCGC
GCAGAATCTGAAGCCAAGAGACTTTCAGATGCAGCTTTTGGAGCGGATATGTTGCATACAATTGGATATGTATACACAAG
ACAAGCAGCTCAAGAACTTGGGAAGAGAGCTCTTTACTTAGGAGTTCCATTTGTAGCTGAATGGGTTAGGAACAAAGGTC
ATTCTTGGAAATCACAGATTAGTGCAGCTAAAGGAGCTTTACAGTTACTTCAGCTGCAAGAAGAGAGTAACCGGAGATTA
AAGAAAGATGGGACTAGTCCAGCAAATGAGTTAGAGTCTCATATTCAGACCAACAAAGAAACATTGATGGGATCTTTGTG
GAAACTTAATGTTGTCGACATTGAAGTGACTCTGTTACATGTGTGTCAGATGGTCTTTCGCGAAAACAATTTGAGAAAGG
AGGAGCTCAAGTCTAGAGCAATGGCTCTCAAGATTCTTGGGAAGATTTTTCAGCAAGAAAAGCAATCGAAGAACGGTACA
ACATCAAGAAAAGAAGATGAAGACAGCGACGATGATGACAGTAGCAGCGATGACGATTCTTCACAACCACTTTCATACAG
AACTCCTCTGCTTACTCAGGGGATTGGTAGACTTTTCAGATGTCTCTGCAATCCAGCATTCGATGTAGACGATGATGAAA
TTGTATACAAAGGCAAATGA