Details for Arabidopsis Locus AT1G77000

Position : Chr1 ( 5`- 28940147 .. 28942623 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G77000

Protein [Map View]
MVSEGATRKELNLCFENMKMEGVLISEWKDIPVELLMKILNLVDDRTVIIASCICSGWRDAVSLGLTRLSLSWCKKNMNS
LVLSLAPKFVKLQTLVLRQDKPQLEDNAVEAIANHCHELQDLDLSKSSKITDHSLYSLARGCTNLTKLNLSGCTSFSDTA
LAHLTRFCRKLKILNLCGCVEAVSDNTLQAIGENCNQLQSLNLGWCENISDDGVMSLAYGCPDLRTLDLCSCVLITDESV
VALANRCIHLRSLGLYYCRNITDRAMYSLAQSGVKNKHEMWRAVKKGKFDEEGLRSLNISQCTYLTPSAVQAVCDTFPAL
HTCSGRHSLVMSGCLNLQSVHCACILQAHRTHTVYPHPAH*

DNA
ATGGTGAGTGAAGGAGCAACAAGAAAAGAACTTAACCTCTGTTTCGAGAATATGAAGATGGAAGGAGTTTTGATCTCTGA
GTGGAAAGATATCCCTGTGGAGCTTCTCATGAAGATTTTAAACCTTGTTGATGATCGGACTGTGATCATTGCTTCTTGTA
TTTGTAGTGGCTGGAGAGATGCTGTTTCCCTTGGCCTCACTCGCCTCTCCCTCTCTTGGTGCAAGAAGAATATGAACAGT
TTGGTTCTATCTCTTGCTCCCAAATTCGTAAAGCTTCAGACTTTAGTACTGCGACAGGACAAACCGCAGCTTGAGGACAA
CGCGGTGGAAGCCATAGCAAATCACTGTCATGAGCTACAAGATTTGGACTTAAGCAAAAGCTCGAAAATCACTGACCATT
CCCTATATTCACTTGCTCGTGGTTGTACTAACCTGACTAAACTCAACCTTAGCGGCTGCACTTCGTTCAGCGACACTGCT
CTTGCGCATTTGACAAGATTTTGCAGGAAGCTCAAAATTCTGAATCTTTGTGGTTGTGTTGAAGCTGTATCTGACAATAC
ATTGCAGGCTATTGGAGAAAACTGCAATCAGTTGCAGTCACTAAACTTGGGATGGTGTGAGAATATAAGTGATGATGGAG
TTATGAGTTTAGCTTATGGTTGTCCTGATTTAAGAACTCTTGATCTTTGTAGCTGTGTTCTAATCACAGATGAGAGTGTT
GTGGCTTTGGCGAATCGGTGCATTCACTTGAGGTCATTGGGGTTATACTACTGCAGAAACATTACAGACAGAGCAATGTA
CTCTTTAGCTCAGAGCGGAGTCAAGAACAAACACGAGATGTGGCGAGCGGTAAAGAAAGGAAAATTCGATGAAGAAGGAC
TAAGAAGCCTTAACATTAGTCAATGCACTTACCTAACACCTTCAGCTGTTCAAGCTGTCTGTGATACATTCCCTGCTCTC
CACACTTGTTCAGGCAGACATTCACTTGTCATGAGCGGTTGTTTGAATCTACAATCTGTTCATTGTGCTTGTATCCTTCA
AGCTCACCGCACTCACACCGTTTACCCTCACCCGGCGCATTGA