Details for Arabidopsis Locus AT1G76980

Position : Chr1 ( 5`- 28925798 .. 28927339 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76980

Protein [Map View]
MAIFDLSSKSFDSHLNFPRTFDDHSDSGVCSPPLWRTSPPKSPAHLHNNYQNLSPVTKAQVIARGQRELMDMVSKMPESC
YELSLKDLVEVNTEEEKVFDEMPQREKKPRKVVRKTKSDKWVDPIRNGGVNNSGFLLKLVFPVSLGAKKKTNKKKDNDDD
DSSVTSKRSWISSPRPSISDLSMKREDKDWWKDGLSESRRSQSVVSRINSGSSKSSGGSSSRSNSDRSRNSLRYPQTLAN
LFRNPLRCFASSSRICFF*

DNA
ATGGCAATTTTCGATCTTTCGTCGAAATCATTCGATAGCCATTTGAATTTTCCGAGAACTTTCGATGATCATTCAGATTC
CGGCGTCTGTTCGCCTCCTCTGTGGAGAACGAGTCCACCGAAAAGTCCTGCTCATCTTCACAACAATTACCAGAATCTCT
CACCTGTTACGAAGGCTCAAGTCATCGCTCGTGGTCAGCGTGAGCTTATGGATATGGTTAGTAAGATGCCCGAGTCGTGT
TACGAGCTTTCGTTGAAGGATCTCGTTGAGGTTAACACGGAGGAGGAGAAGGTGTTCGATGAAATGCCTCAGAGAGAAAA
AAAGCCGAGGAAAGTCGTGAGGAAGACGAAGAGTGATAAATGGGTGGATCCGATTCGAAACGGAGGTGTTAATAATAGTG
GGTTTCTTCTGAAACTGGTGTTTCCTGTTAGCTTGGGTGCTAAGAAAAAGACTAATAAGAAGAAAGATAATGATGATGAT
GATTCTTCTGTGACAAGTAAAAGGTCTTGGATTTCTTCTCCTAGACCTTCGATCTCTGATCTGTCGATGAAACGAGAGGA
TAAAGATTGGTGGAAGGATGGATTGTCAGAATCTCGTAGGAGTCAAAGTGTTGTCTCGAGGATCAACAGTGGGAGCTCAA
AGAGCAGTGGTGGTAGTAGCAGTAGAAGCAATAGTGATCGAAGCCGAAACAGTCTAAGGTATCCACAAACTCTGGCCAAT
TTATTTAGGAATCCGTTGAGGTGTTTTGCATCTAGTTCTAGAATTTGCTTTTTCTGA