Details for Arabidopsis Locus AT1G76970

Position : Chr1 ( 5`- 28922666 .. 28925404 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76970

Protein [Map View]
MANDAAACAERATNDMLIGPDWAINIELCDLINMDPSQAKEAVKVLKKRLGSKNSKVQILALYALETLSKNCGENVYQLI
IDRGLLNDMVKIVKKKPELNVREKILTLLDTWQEAFGGRGGRYPQYYNAYNDLRSAGIEFPPRTESSLSFFTPPQTQPDE
DAAIQASLQGDDASSLSLEEIQSAEGSVDVLMDMLGAHDPGNPESLKEEVIVDLVEQCRTYQRRVMTLVNTTTDEELLCQ
GLALNDNLQHVLQRHDDIANVGSVPSNGRNTRAPPPVQIVDINHDDEDDESDDEFARLAHRSSTPTRRPVHGSDSGMVDI
LSGDVYKPQGNSSSQGVKKPPPPPPHTSSSSSSPVFDDASPQQSKSSEVIRNLPPPPSRHNQRQQFFEHHHSSSGSDSSY
EGQTRNLSLTSSEPQKEEKPEDLLFKDLVEFAKTRSSKANNNNRSL*

DNA
ATGGCAAATGATGCGGCTGCATGTGCAGAAAGGGCTACAAATGATATGCTGATTGGTCCAGATTGGGCTATTAACATTGA
ATTGTGTGATCTTATCAACATGGATCCTAGTCAAGCAAAAGAAGCTGTGAAGGTGCTCAAGAAGCGGTTAGGAAGTAAAA
ACTCTAAAGTCCAGATTCTTGCACTTTATGCATTGGAAACTTTAAGTAAGAATTGTGGCGAAAACGTGTACCAGCTTATC
ATTGACCGTGGTCTATTGAATGACATGGTCAAAATAGTGAAGAAAAAGCCGGAACTGAATGTGAGGGAAAAGATACTAAC
TTTGTTAGACACATGGCAAGAAGCCTTTGGTGGACGTGGAGGTCGATACCCACAATACTACAATGCCTATAACGATCTCA
GGTCTGCTGGAATTGAGTTTCCGCCTCGAACGGAAAGCAGTCTATCGTTCTTTACTCCACCGCAGACTCAGCCAGATGAA
GATGCTGCTATTCAGGCTTCGTTGCAAGGAGATGATGCTTCTAGCCTCAGCCTGGAAGAGATTCAAAGCGCTGAGGGATC
AGTTGATGTTTTGATGGACATGCTTGGAGCACATGATCCCGGGAATCCCGAGAGTTTAAAAGAAGAAGTTATAGTAGACT
TGGTTGAGCAATGTCGTACTTATCAAAGACGTGTAATGACTCTTGTGAACACTACAACAGATGAGGAACTTCTGTGTCAG
GGATTGGCATTAAACGATAATTTGCAGCATGTTCTTCAGCGTCACGATGATATCGCAAATGTCGGCTCTGTTCCTTCAAA
TGGAAGGAATACTAGAGCTCCTCCTCCAGTTCAGATTGTTGACATCAATCATGATGATGAAGATGACGAATCAGATGATG
AGTTTGCTCGGCTTGCTCACAGGTCTTCAACACCTACAAGGAGACCAGTACATGGTAGTGATTCGGGTATGGTGGATATC
CTTAGTGGGGACGTCTATAAACCTCAAGGCAACTCCTCCTCACAGGGAGTAAAGAAGCCTCCTCCTCCTCCTCCGCATAC
TTCTTCTTCCTCTTCTTCTCCTGTTTTCGATGATGCAAGTCCACAACAAAGCAAATCCTCTGAGGTAATTAGGAATCTTC
CACCTCCGCCTTCAAGGCACAACCAGAGGCAACAGTTCTTTGAGCATCACCACTCGAGTAGCGGCTCAGATTCCTCTTAC
GAGGGACAGACCCGGAACCTTTCTTTGACAAGTAGTGAACCGCAGAAAGAAGAGAAACCAGAGGATTTGCTTTTCAAAGA
CCTGGTTGAGTTCGCCAAAACCAGGTCCTCCAAAGCCAACAATAATAATAGGTCGCTCTGA