Details for Arabidopsis Locus AT1G76965

Position : Chr1 ( 5`- 28921729 .. 28922292 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76965

Protein [Map View]
MEIIPLMLISVIILLTSFPAPIKVSGRGGGGGFVGSGNSPSIGSGYFGGGGNPGTGYMGGGIPSGGSIRDGSNVGTGYRG
GFQGGKPSGGGDPGAAIVVFPKKPEEPVKVVPTPMPQVCEPKVRHCINVHVYGRAGQPHRGGACCNKFRYARRCVCKFLV
SNDTHLNKQSNGVLRGCHFKRNCVFRN*

DNA
ATGGAGATCATTCCATTGATGCTCATTTCCGTTATCATACTCTTGACATCATTTCCGGCTCCGATTAAAGTGTCCGGCAG
GGGTGGAGGAGGCGGCTTTGTTGGTAGTGGCAACTCTCCTAGTATTGGAAGCGGCTATTTTGGTGGTGGTGGGAATCCTG
GCACCGGCTATATGGGTGGGGGTATCCCTAGCGGCGGCAGCATTAGGGATGGGAGTAATGTTGGCACCGGTTATAGGGGT
GGGTTTCAAGGAGGCAAGCCTTCAGGTGGTGGTGACCCCGGTGCGGCAATTGTGGTGTTTCCTAAGAAGCCCGAGGAACC
TGTGAAGGTGGTGCCAACGCCAATGCCACAAGTTTGCGAACCGAAAGTTAGACATTGCATCAATGTACATGTATACGGAC
GCGCCGGGCAACCTCACCGAGGCGGAGCATGTTGTAACAAATTTAGGTACGCGAGAAGATGTGTCTGTAAATTCCTTGTG
TCTAATGATACTCACCTAAACAAACAATCTAATGGTGTACTTCGAGGTTGTCATTTTAAACGCAATTGTGTCTTCCGTAA
CTAA