Details for Arabidopsis Locus AT1G76952

Position : Chr1 ( 5`- 28914284 .. 28914952 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76952

Protein [Map View]
MGNKRIKAMMILVVMIMMVFSWRICEADSLRRYSSSSRPQRFFKVRRPNPRNHHHQNQGFNGDDYPPESFSGFLPKTLPI
PHSAPSRKHNVYGLQRTNSRSSYFWTHAHLS*

DNA
ATGGGCAATAAACGCATAAAAGCAATGATGATTCTAGTGGTAATGATCATGATGGTGTTCTCATGGAGGATTTGTGAAGC
CGATAGCTTAAGAAGATACTCATCATCGTCAAGACCACAAAGATTTTTCAAGGTGAGAAGACCTAACCCCCGTAATCATC
ATCATCAGAATCAAGGTTTCAATGGTGATGATTATCCTCCAGAAAGTTTCTCAGGATTTTTGCCCAAGACATTGCCAATT
CCACATTCTGCTCCTTCCAGGAAACACAACGTCTACGGTTTACAGAGAACCAACTCAAGGTCGAGCTATTTTTGGACGCA
CGCCCACTTATCTTAA