Details for Arabidopsis Locus AT1G76940

Position : Chr1 ( 5`- 28902428 .. 28904311 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76940

Protein [Map View]
MADGYWNQQRQQHHPPGGPMKRPRSDFEAPSSTMTIGHGGGYYPRDEDLDVPDTRTIGSAYDRYLQSVQSGEGGSVSMGR
SGGGGGGGGGNVQTIDDFMLRRGGVLPLDHGPNGHTIGFDPPEPVGRRNLPSDASNTLYVEGLPSNCSRREVAHIFRPFV
GYREVRLVTKDSKHRNGDPIVLCFVDFTNPACAATALSALQGYRMDENESDSKFLRLQFSRKPGSRPGQRGRR*

DNA
ATGGCGGATGGGTACTGGAACCAGCAGCGACAGCAACATCATCCTCCTGGTGGTCCTATGAAACGTCCCCGTTCCGATTT
CGAAGCTCCATCATCAACAATGACTATAGGGCACGGTGGTGGTTATTATCCGCGAGATGAGGATCTCGATGTTCCCGATA
CTAGAACTATCGGTTCAGCTTACGATCGCTATCTCCAGAGCGTGCAATCAGGAGAAGGTGGTTCTGTTTCCATGGGAAGA
TCAGGAGGAGGAGGAGGAGGAGGAGGAGGTAACGTTCAAACCATAGATGATTTTATGTTGAGACGTGGTGGAGTTCTCCC
TTTAGACCATGGTCCAAATGGTCACACCATTGGTTTTGATCCCCCAGAACCTGTTGGTAGGCGTAACCTACCTTCAGATG
CATCCAACACTTTATATGTTGAAGGACTTCCTTCTAATTGCTCTAGGAGGGAAGTAGCTCATATATTTCGACCTTTTGTA
GGATACAGAGAAGTGAGACTTGTGACCAAAGACTCCAAACATCGGAACGGAGATCCTATTGTTCTTTGCTTTGTTGATTT
TACAAACCCTGCCTGTGCTGCGACTGCTCTGAGCGCCTTACAAGGCTATCGAATGGACGAAAACGAGTCTGATTCCAAGT
TCCTGCGGCTCCAGTTTTCTAGGAAACCAGGTTCAAGACCAGGACAAAGAGGAAGAAGGTGA