Details for Arabidopsis Locus AT1G76890

Position : Chr1 ( 5`- 28873059 .. 28875292 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76890

Protein [Map View]
MSGNSEGLLESSGGGVGGSVEEEKDMKMEETGEGAGSGGNRWPRPETLALLRIRSEMDKAFRDSTLKAPLWEEISRKMME
LGYKRSSKKCKEKFENVYKYHKRTKEGRTGKSEGKTYRFFEELEAFETLSSYQPEPESQPAKSSAVITNAPATSSLIPWI
SSSNPSTEKSSSPLKHHHQVSVQPITTNPTFLAKQPSSTTPFPFYSSNNTTTVSQPPISNDLMNNVSSLNLFSSSTSSST
ASDEEEDHHQVKSSRKKRKYWKGLFTKLTKELMEKQEKMQKRFLETLEYREKERISREEAWRVQEIGRINREHETLIHER
SNAAAKDAAIISFLHKISGGQPQQPQQHNHKPSQRKQYQSDHSITFESKEPRAVLLDTTIKMGNYDNNHSVSPSSSRWPK
TEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRRLGYNRSAKRCKEKWENINKYFKKVKESNKKRPLDSKTCPYFHQL
EALYNERNKSGAMPLPLPLMVTPQRQLLLSQETQTEFETDQREKVGDKEDEEEGESEEDEYDEEEEGEGDNETSEFEIVL
NKTSSPMDINNNLFT*

DNA
ATGTCTGGAAACTCAGAAGGACTGTTAGAGAGCTCAGGCGGCGGCGTGGGAGGTTCCGTCGAGGAGGAAAAAGATATGAA
GATGGAGGAAACCGGTGAAGGAGCCGGCAGCGGAGGAAACCGGTGGCCAAGACCAGAGACTTTAGCTCTATTGAGAATAC
GTTCAGAGATGGATAAAGCTTTTCGTGACTCTACTCTCAAAGCTCCCTTATGGGAAGAAATTTCCAGGAAAATGATGGAG
CTTGGTTACAAGAGAAGTTCAAAGAAATGCAAGGAGAAGTTCGAGAACGTGTACAAGTACCACAAACGTACCAAAGAAGG
TCGTACCGGGAAATCCGAAGGCAAAACTTACCGGTTTTTCGAAGAGTTAGAAGCTTTCGAGACTCTCAGTTCCTATCAAC
CTGAACCTGAGTCGCAACCCGCGAAATCTTCTGCAGTGATCACGAACGCGCCCGCAACCTCTTCCTTGATACCATGGATT
AGCTCTAGCAATCCATCAACCGAAAAAAGTTCTTCACCGTTGAAACATCATCATCAGGTTAGTGTACAACCCATCACCAC
AAACCCTACCTTCCTCGCCAAGCAACCATCTTCCACGACGCCTTTTCCTTTTTATAGCAGCAACAATACTACTACTGTTA
GCCAGCCGCCAATTTCAAATGACTTGATGAACAATGTTTCATCGCTGAATCTTTTCTCGAGCTCAACTTCTTCATCTACT
GCATCTGACGAGGAAGAAGATCATCATCAGGTTAAGAGCTCGAGAAAGAAGAGGAAGTATTGGAAAGGGTTGTTTACGAA
GTTGACAAAAGAGTTAATGGAGAAACAAGAGAAGATGCAAAAAAGGTTCTTGGAAACACTGGAGTATCGTGAGAAAGAGA
GAATCTCAAGAGAAGAAGCTTGGAGGGTCCAAGAGATAGGGAGAATCAACAGAGAACACGAAACATTAATCCATGAGAGG
TCCAATGCTGCAGCTAAAGACGCTGCAATCATATCCTTCTTACACAAAATCTCAGGAGGACAACCACAACAACCGCAACA
ACATAATCATAAACCATCACAAAGGAAACAATATCAAAGCGATCATTCAATAACGTTTGAGAGTAAAGAGCCGAGGGCGG
TTCTATTGGATACAACAATAAAGATGGGGAATTACGATAACAATCATTCGGTGTCTCCTAGTTCTTCAAGATGGCCTAAA
ACCGAGGTCGAGGCCTTGATAAGGATAAGAAAGAATCTTGAAGCTAACTATCAAGAAAACGGTACTAAGGGACCATTATG
GGAAGAGATCTCTGCAGGGATGAGAAGATTGGGATACAATAGAAGCGCGAAACGCTGCAAAGAGAAGTGGGAAAACATCA
ACAAGTACTTTAAGAAAGTCAAAGAAAGCAACAAGAAACGTCCCCTTGATTCCAAGACTTGCCCTTATTTTCACCAGCTC
GAAGCTTTGTACAACGAGAGGAACAAAAGTGGGGCAATGCCATTGCCATTGCCTCTAATGGTGACTCCACAGAGACAGTT
GCTTCTCTCGCAAGAAACCCAGACCGAGTTTGAGACTGATCAGAGGGAAAAAGTTGGTGATAAAGAAGATGAAGAAGAAG
GAGAGAGTGAAGAAGATGAATACGATGAAGAAGAAGAGGGAGAAGGAGACAATGAGACAAGTGAGTTCGAGATTGTGTTG
AACAAAACATCTTCACCTATGGACATTAACAATAATCTTTTCACCTAA