Details for Arabidopsis Locus AT1G76860

Position : Chr1 ( 5`- 28854414 .. 28855750 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76860

Protein [Map View]
MSGEEEATVREPLDLIRLSLDERIYVKLRSDRELRGKLHAFDQHLNMILGDVEETITTVEIDDETYEEIVRTTKRTIEFL
FVRGDGVILVSPPLRTAA*

DNA
ATGTCCGGCGAGGAAGAAGCCACCGTGAGGGAGCCACTAGATCTGATTAGGCTGAGTCTCGACGAGAGAATCTATGTCAA
GCTCCGGTCAGACCGCGAACTTCGCGGCAAGCTTCACGCGTTTGATCAGCATTTGAATATGATTCTGGGTGATGTTGAAG
AAACTATCACTACAGTAGAAATCGATGACGAGACATATGAAGAGATTGTTCGGACTACAAAGCGGACGATTGAGTTTCTA
TTCGTGAGAGGAGATGGAGTGATATTGGTGTCTCCACCGCTGAGGACAGCAGCCTGA