Details for Arabidopsis Locus AT1G76770

Position : Chr1 ( 5`- 28813569 .. 28814378 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76770

Protein [Map View]
MELELGLKITRTKDDVSSSTDFRVARDSFGHRSLSRETNSVFFLILHLKGFKKDGIDIEINKEGNLIKISGRKQVEEMVL
VKWVEWKKETEIKEFKKVFRIPDIVILDKIKARFNEEDGTLTVTMPKKVKGITGLKIEEEDEEEEMKEPIVEEKTEEKTE
PEEEIKEETKPEEENEEAEEPQREEEEEVVEEGTRDHEGKKEEEIEDKPRKKRRKKFRLPCFAGSTLLMSIIVFIIQLIQ
SRNK*

DNA
ATGGAGCTTGAATTAGGTCTGAAGATCACTCGGACTAAAGACGATGTTTCTTCCTCTACAGATTTTCGGGTTGCCAGAGA
TTCTTTTGGTCATCGTTCACTTTCTCGAGAAACCAACTCTGTTTTCTTCCTCATTCTTCATCTCAAAGGATTTAAGAAGG
ATGGTATCGATATCGAGATAAACAAAGAAGGGAATCTGATTAAGATCAGCGGAAGAAAACAGGTTGAAGAGATGGTTTTG
GTAAAGTGGGTGGAATGGAAAAAGGAAACAGAAATAAAGGAATTCAAAAAAGTGTTTCGGATTCCAGATATTGTAATTCT
TGACAAGATCAAAGCGAGGTTTAATGAAGAAGATGGGACTTTAACTGTTACAATGCCTAAGAAAGTTAAGGGAATTACCG
GTCTGAAGATCGAGGAAGAGGACGAAGAAGAGGAGATGAAAGAGCCGATAGTAGAAGAGAAAACAGAGGAGAAAACAGAA
CCAGAAGAAGAAATCAAAGAAGAGACAAAACCTGAGGAAGAAAACGAAGAAGCAGAAGAGCCACAGAGAGAAGAGGAAGA
AGAGGTTGTTGAGGAAGGAACAAGAGATCATGAGGGGAAAAAAGAAGAAGAAATCGAAGATAAACCAAGAAAGAAGAGAA
GAAAAAAGTTTCGTTTACCATGTTTTGCAGGATCCACTCTGCTTATGTCTATTATTGTTTTCATTATTCAACTGATTCAA
TCCAGAAATAAATGA