Details for Arabidopsis Locus AT1G76760

Position : Chr1 ( 5`- 28811685 .. 28813070 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76760

Protein [Map View]
MASISLSSSTVPSLNSKESSGVSAFASRSISAVKFQFPVRRVRTGDLKFPSLSSTTRCTPRRIEAKKQTFDSFEDLLVNS
DKPVLVDYYATWCGPCQFMVPILNEVSETLKDKIQVVKIDTEKYPSIANKYKIEALPTFILFKDGEPCDRFEGALTAKQL
IQRIEDSLKVKP*

DNA
ATGGCGTCAATTTCTCTCTCTTCTTCTACGGTTCCGTCGCTGAATTCGAAAGAATCGTCAGGTGTTTCTGCTTTCGCTTC
TCGTTCTATCTCGGCCGTCAAATTTCAGTTTCCGGTTCGTCGGGTTCGAACCGGAGACTTAAAGTTTCCATCTTTATCTT
CAACGACTCGATGCACTCCTCGACGTATTGAAGCCAAGAAGCAGACATTTGACTCATTTGAGGATCTGCTTGTGAACTCT
GATAAACCAGTTCTAGTTGACTATTATGCAACCTGGTGTGGTCCTTGCCAGTTCATGGTTCCAATACTCAATGAAGTGAG
TGAAACCCTGAAAGACAAGATACAGGTGGTGAAGATTGATACCGAAAAATACCCCAGTATTGCTAATAAATACAAGATTG
AGGCACTTCCTACTTTCATCCTATTCAAAGATGGGGAACCTTGTGATCGCTTTGAGGGTGCTTTGACGGCCAAACAACTC
ATTCAACGAATTGAGGATTCTCTAAAAGTGAAGCCATAG