Details for Arabidopsis Locus AT1G76740

Position : Chr1 ( 5`- 28805235 .. 28810557 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76740

Protein [Map View]
MNFHGMKRKDLQALCKKNGIPANLKNIEMATRLASVLQKETEGTLTDTISLSEDSVDVLEDDVAVKKVRFSPENEVFEFT
RSLKRCQRKYVSKRKVQESGIELRRSKRSVAKGKAIAGSSENESNTRRGNRSDVTKAIEVPRRSKRSGSTGSSQEDCKVT
ELMALEQFEFENISEGLSGSDQDGFKFEKIGRRSTQLISKTGNLLPVNKSKRLVDIKDNEDELVKNNVNEVSMDQRRSIR
LKARAANQSMGGESSDGRPLCSAKETKEEIKIKQSKRSTVVSSQKELVERKAKEPLVDSKVPRRSKRLANDVNVLLDKRP
VKAVKPDYLKVKKAPKQSRRLEKSLSELLIDGQAQKGDKQRTFGNGREGKKLLRSSKHTASNNMLGQALSNSLKRCSVID
GERAGVSVGDVKKSNVNNEMQIRVRVTRNSSRHHSFKAPIEFERNLIEKKSDETFVKSSKRGTRRMKRGRSAEPGKDIET
QSNLTSKKLLNEYTQFEQEEACDANVEVRGSSKKAKTMNQECVKDIPQVMTENSPSSSETIAAESVMIVENVLDSSPEKS
VDSSQRTNTQELNSEVMEGKHEEKLEGDTVLMVAIEEEKKEVSSSSVLLSERLSPTSVQFAVSNSKAELVVPTGHILLND
FAEENSKTKEEGLIFTPVSELKEPISVEAILENSVECWNEIHLSKHDEKGTNIQAENLHGNFSECNTENSKVVIVHPEML
DEISVSHCVDLEMLDEVKNGNLEKSEQRSGCKLNPLELKRFSSTDFTSHSLKEKKVSKCFKEDELRAWSEPLPRNKNASA
FDELAIFTTPERNLMLRGKLSENGKTLAADSVIHHNVIAVESHAVVFTASKQAGTDEAGKEEEHTATNFPDESDVFNTTK
KLGGSRQTEARNEGESIVVELHDESDIATSLERQLSAGDSKGEGIGRNEENMTVELHCEPDTCTSPDGHTLLGNYVSDGA
ENSEENKAMEFNDESVDLTASERHEICRSFGQDRARESEGKKVVLFYEESLHSDQPLADSELGEAECQEINSADKSSLFT
SLERQQLFYECYVPNVREDSERDEAATSEENKAVELQVDCGIFTTPEKHLLLETDEGVKGDNITAKSHVLSDVLAADVPH
SLMGDSEPDEAEKTSVEIKDVELLGESNSSTNPESPTLFGNSELDESRDSSAATCEEAFVTTSPEKELLINPGKQEQKEV
DENVVQESHVAAPDFRGNTIVDSSGGIASKVSYNHELNAGQETACAELMSKGSQAEDVVGLDATQGTSKKRRGHSPHADS
VNLFDSNIEEVDTIMEAERNISFSSYVAVPAEGNSETIGEISSYLEVAGTCSMVFDESGSSTDIQNQINDALKEWAITDK
NEADELIEAIVTKNIQKDFEGNLLLNSSGGGSNVSGETSILAGTADEDEAAGPIAIAFVKAMSLTPDELTVKNHMNEKAA
DEEMITRETTPIPEETINESSENRKEYSSIDESATLSEMQVRREPTLIFRTQVKPTKHDMKENAPNSKIVHNLNVTAPRT
SKRQPLQDLNKN*

DNA
ATGAATTTTCATGGAATGAAGAGGAAGGATCTACAAGCTCTATGCAAAAAGAATGGAATCCCAGCAAATTTGAAGAACAT
TGAGATGGCTACTAGACTCGCTTCTGTTCTCCAGAAGGAAACTGAAGGAACTTTAACGGATACGATAAGTTTGTCTGAGG
ATTCTGTTGATGTTCTTGAGGATGATGTAGCTGTTAAGAAAGTAAGATTCAGTCCTGAGAATGAAGTATTTGAATTCACT
CGGTCTCTCAAGAGATGTCAGCGGAAGTATGTTAGCAAAAGGAAAGTTCAAGAAAGTGGAATAGAGCTAAGGCGGTCAAA
GCGAAGTGTTGCTAAAGGGAAAGCAATAGCTGGATCTAGTGAAAACGAGTCAAACACAAGAAGAGGTAACCGGTCTGATG
TTACAAAGGCTATCGAGGTCCCAAGGCGGTCGAAACGAAGTGGCTCTACCGGTAGTAGTCAAGAAGACTGTAAAGTAACG
GAGTTGATGGCTTTGGAACAGTTTGAGTTTGAAAATATCTCGGAAGGATTGTCTGGAAGTGATCAGGATGGTTTCAAGTT
TGAAAAGATTGGGAGACGCTCCACACAGCTGATATCGAAGACAGGAAACTTATTACCTGTTAATAAGTCAAAACGACTTG
TAGACATCAAAGATAATGAAGATGAGCTTGTTAAGAATAATGTGAATGAGGTATCTATGGATCAGAGAAGGTCAATAAGG
CTTAAAGCTAGAGCTGCAAACCAATCAATGGGAGGTGAGTCATCCGATGGTAGACCCTTATGCTCTGCTAAGGAAACTAA
AGAAGAAATAAAGATTAAGCAGTCAAAAAGATCTACGGTGGTCAGTAGTCAAAAAGAGCTTGTTGAGAGAAAAGCAAAGG
AGCCTTTAGTAGATAGCAAAGTTCCTAGGCGTTCGAAACGTCTTGCGAACGATGTAAATGTGCTACTGGATAAGAGACCC
GTTAAGGCTGTGAAACCTGATTATCTGAAAGTCAAAAAGGCTCCAAAACAGTCTAGGCGACTTGAGAAGAGTCTCAGTGA
ACTCCTAATAGATGGCCAAGCTCAAAAGGGTGATAAACAGCGAACTTTTGGAAATGGTCGTGAGGGTAAAAAGCTTCTAC
GAAGTTCGAAACACACTGCATCAAATAATATGTTGGGTCAAGCACTGAGTAATTCACTGAAACGTTGTTCAGTTATTGAC
GGTGAACGAGCTGGAGTCTCTGTTGGTGATGTGAAGAAGTCAAATGTGAATAATGAAATGCAGATCCGTGTTAGAGTTAC
TAGGAACTCTTCGAGGCATCATTCATTTAAGGCTCCAATAGAGTTTGAAAGGAATCTTATTGAAAAGAAGTCGGATGAAA
CTTTTGTCAAATCATCTAAAAGAGGTACTAGGAGGATGAAGCGGGGCAGATCAGCAGAGCCAGGGAAGGACATAGAAACT
CAGAGCAATCTAACGTCAAAAAAACTTTTGAATGAGTATACTCAGTTTGAGCAAGAAGAAGCATGTGACGCTAATGTGGA
AGTTAGAGGCTCCTCCAAGAAGGCAAAGACGATGAATCAAGAATGCGTTAAGGATATACCACAAGTAATGACTGAGAACT
CACCTTCTTCATCCGAAACCATAGCTGCGGAATCTGTTATGATTGTTGAGAATGTTTTGGATTCTTCACCGGAAAAATCA
GTTGATAGTTCTCAAAGAACAAACACTCAAGAGTTGAATTCGGAAGTTATGGAAGGAAAACATGAAGAGAAACTTGAGGG
AGACACAGTTTTGATGGTTGCGATTGAGGAGGAAAAAAAGGAAGTATCATCAAGCTCTGTACTTCTTAGTGAGCGTTTAT
CACCTACTTCAGTACAATTTGCAGTAAGCAACTCTAAAGCTGAGCTAGTTGTCCCTACCGGCCATATCCTTCTTAATGAT
TTTGCTGAGGAAAATAGCAAAACCAAGGAGGAGGGCCTTATTTTCACTCCTGTATCTGAGCTTAAGGAGCCCATCTCTGT
AGAAGCAATCTTGGAAAACTCAGTTGAATGTTGGAACGAGATTCATTTAAGCAAACATGATGAGAAAGGTACTAATATAC
AAGCAGAAAATCTACATGGAAACTTCTCTGAATGCAACACTGAGAATAGTAAGGTTGTCATTGTCCATCCGGAGATGCTG
GATGAGATAAGTGTCAGTCATTGTGTAGACCTGGAGATGCTGGATGAGGTCAAGAATGGCAATCTGGAGAAATCCGAGCA
AAGAAGTGGCTGTAAACTTAATCCGTTGGAGCTAAAAAGATTCTCGTCAACTGACTTCACTTCTCATTCTCTCAAGGAAA
AGAAGGTTTCAAAGTGTTTTAAGGAAGACGAACTAAGAGCTTGGTCCGAACCTCTACCCAGAAACAAAAATGCTAGCGCC
TTTGATGAGTTAGCTATATTCACTACCCCAGAGAGGAACTTAATGTTGAGGGGAAAACTCAGTGAAAATGGAAAGACGCT
TGCAGCTGATTCAGTTATCCATCACAATGTTATAGCAGTAGAGTCTCACGCTGTTGTTTTCACAGCTTCTAAACAAGCTG
GGACAGATGAGGCCGGAAAGGAAGAAGAACATACAGCTACCAACTTTCCGGATGAATCTGATGTTTTCAATACCACCAAG
AAATTGGGAGGCTCCAGACAAACCGAAGCTAGAAATGAAGGCGAAAGTATAGTTGTTGAGCTTCATGATGAGTCTGACAT
TGCTACTAGTCTAGAAAGACAACTCAGTGCGGGAGACTCTAAAGGAGAGGGAATCGGTAGGAATGAAGAAAATATGACTG
TTGAGCTCCATTGTGAACCTGACACTTGCACTAGCCCGGATGGACATACACTCTTGGGAAATTATGTATCAGATGGAGCA
GAAAATAGTGAAGAGAACAAAGCTATGGAGTTCAATGACGAATCTGTTGATTTAACTGCTTCAGAGAGACATGAGATTTG
TAGATCTTTTGGACAAGATAGAGCTAGAGAAAGTGAAGGAAAAAAGGTTGTGCTGTTCTATGAGGAATCGCTACACAGTG
ATCAACCTTTAGCAGATTCTGAACTAGGCGAAGCAGAATGTCAAGAAATCAACAGTGCTGACAAGTCAAGTCTTTTTACA
AGCCTGGAGAGACAACAACTATTCTATGAGTGTTATGTTCCCAATGTTCGAGAAGACTCGGAACGGGACGAAGCTGCAAC
AAGTGAAGAAAACAAGGCTGTGGAATTGCAAGTTGACTGTGGCATTTTCACAACTCCCGAGAAACATTTACTACTTGAAA
CAGATGAAGGGGTAAAAGGAGACAATATAACCGCCAAGTCACATGTTTTGTCTGATGTTCTCGCTGCTGATGTGCCCCAT
TCTCTTATGGGAGACTCTGAGCCAGATGAAGCTGAAAAAACCTCCGTAGAGATCAAGGATGTGGAATTGTTGGGTGAATC
TAACTCTTCCACTAATCCAGAGAGCCCCACACTGTTTGGAAACTCCGAACTAGATGAATCAAGAGATTCTTCAGCAGCCA
CGTGCGAAGAGGCTTTTGTTACCACTTCTCCAGAGAAAGAACTTTTAATTAACCCTGGAAAGCAAGAACAAAAGGAGGTG
GACGAAAATGTGGTTCAGGAAAGTCACGTTGCAGCTCCAGATTTCAGAGGAAACACCATTGTTGACTCAAGCGGTGGTAT
CGCATCCAAAGTTTCTTACAACCATGAGCTTAATGCGGGGCAAGAAACTGCATGTGCAGAGTTAATGTCAAAAGGTTCTC
AGGCAGAGGATGTTGTAGGTCTTGATGCTACACAAGGGACATCAAAGAAAAGAAGAGGGCATTCTCCACATGCTGACTCA
GTAAATCTTTTTGATTCTAACATTGAGGAGGTAGATACAATCATGGAAGCAGAAAGAAATATTTCCTTTAGCTCCTATGT
TGCGGTACCAGCCGAGGGTAACTCCGAGACAATTGGCGAAATTTCCAGCTACCTTGAAGTTGCTGGAACCTGTTCCATGG
TGTTTGATGAATCTGGATCTTCCACAGACATTCAGAACCAAATAAATGATGCGCTGAAGGAATGGGCAATAACAGACAAA
AATGAAGCAGATGAGCTCATAGAAGCAATTGTAACTAAGAACATTCAAAAAGACTTCGAAGGAAATCTCCTTCTGAACTC
CTCAGGTGGTGGCTCTAATGTCTCTGGAGAAACAAGCATCTTAGCTGGAACGGCGGATGAAGATGAAGCAGCTGGTCCAA
TTGCTATTGCCTTCGTTAAAGCTATGTCTCTGACTCCTGATGAATTGACTGTTAAGAATCACATGAATGAAAAAGCTGCA
GATGAGGAAATGATCACGAGAGAAACTACTCCAATTCCTGAAGAAACCATCAATGAGTCTTCTGAGAACAGGAAGGAGTA
TTCAAGCATTGATGAATCAGCTACGTTATCCGAGATGCAAGTAAGAAGAGAACCAACCTTGATTTTCAGAACACAAGTGA
AGCCTACGAAGCATGACATGAAAGAGAATGCACCAAACTCAAAAATTGTGCATAATCTTAACGTAACAGCTCCAAGAACA
TCAAAGAGACAGCCTCTCCAAGACTTGAACAAGAACTAG