Details for Arabidopsis Locus AT1G76710

Position : Chr1 ( 5`- 28789729 .. 28792676 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76710

Protein [Map View]
MQFSCDPDQEGDELPQYEHIYQNDFSYRKHKKQKEEDISICECKFDFGDPDSACGERCLNVITNTECTPGYCPCGVYCKN
QKFQKCEYAKTKLIKCEGRGWGLVALEEIKAGQFIMEYCGEVISWKEAKKRAQTYETHGVKDAYIISLNASEAIDATKKG
SLARFINHSCRPNCETRKWNVLGEVRVGIFAKESISPRTELAYDYNFEWYGGAKVRCLCGAVACSGFLGAKSRGFQEDTY
VWEDGDDRYSVDKIPVYDSAEDELTSEPSKNGESNTNEEKEKDISTENHLESTALNIQQQSDSTPTPMEEDVVTETVKTE
TSEDMKLLSQNSQEDSSPKTAIVSRVHGNISKIKSESLPKKRGRPFSGGKTKNVAQKHVDIANVVQLLATKEAQDEVLKY
EEVKKEAAVRLSSLYDEIRPAIEEHERDSQDSVATSVAEKWIQASCNKLKAEFDLYSSVIKNIASTPIKPQDTKTKVAEA
GNEDHIKLLEAK*

DNA
ATGCAATTTTCTTGTGATCCTGATCAAGAAGGAGATGAGCTGCCACAATATGAACACATTTATCAAAATGACTTCTCTTA
TCGAAAGCACAAGAAACAAAAGGAAGAAGATATATCTATCTGCGAATGCAAGTTTGATTTCGGAGACCCTGACAGTGCTT
GTGGTGAGAGATGCCTCAATGTCATTACCAACACTGAATGTACTCCTGGTTACTGCCCCTGTGGTGTCTATTGCAAGAAT
CAGAAGTTCCAAAAATGTGAATACGCCAAAACAAAGTTGATCAAGTGTGAAGGTCGTGGTTGGGGACTAGTGGCTCTTGA
AGAGATAAAGGCGGGGCAATTTATAATGGAGTACTGTGGTGAAGTAATATCATGGAAAGAAGCAAAGAAGAGGGCTCAAA
CTTATGAAACTCATGGTGTCAAGGATGCATACATTATATCTCTCAATGCATCTGAGGCTATTGATGCCACTAAGAAGGGA
AGCCTTGCTAGGTTTATAAATCATTCATGTAGACCAAATTGTGAGACGAGGAAGTGGAATGTACTGGGAGAAGTTAGGGT
TGGGATCTTTGCAAAAGAGAGCATCTCTCCCCGGACCGAATTGGCTTACGACTATAATTTTGAATGGTACGGTGGTGCCA
AAGTGCGTTGTCTCTGTGGTGCGGTTGCATGCTCTGGATTTCTTGGAGCCAAGTCTCGTGGCTTTCAGGAGGATACATAT
GTATGGGAGGATGGTGACGATCGGTATTCAGTTGATAAAATTCCAGTCTATGATTCTGCAGAGGACGAGCTTACATCTGA
GCCTTCTAAGAATGGCGAGTCCAACACAAATGAAGAGAAAGAGAAAGATATCTCAACAGAGAACCATTTGGAGTCTACTG
CTCTGAATATTCAACAGCAATCAGATTCAACTCCAACTCCTATGGAGGAAGATGTCGTCACGGAGACTGTTAAAACCGAA
ACATCTGAAGACATGAAGCTGCTCTCACAAAATTCACAAGAAGATTCATCGCCAAAGACTGCAATTGTATCACGGGTTCA
CGGTAACATTTCCAAGATCAAGTCCGAATCTCTTCCGAAGAAAAGAGGCAGGCCGTTTTCAGGCGGAAAAACAAAGAATG
TCGCTCAGAAGCATGTTGACATAGCGAATGTGGTTCAGCTACTAGCAACCAAAGAAGCTCAAGATGAAGTTCTCAAATAC
GAGGAGGTGAAGAAGGAAGCAGCAGTACGACTCTCGTCATTGTACGACGAGATAAGGCCGGCGATTGAGGAGCATGAAAG
AGATAGCCAAGACAGTGTAGCAACAAGTGTGGCGGAGAAATGGATACAAGCAAGCTGTAATAAACTCAAGGCAGAGTTTG
ATCTTTACTCTAGTGTAATAAAGAACATCGCTTCCACTCCCATCAAACCACAAGACACAAAGACCAAAGTCGCGGAAGCA
GGAAACGAAGACCATATTAAACTCTTGGAAGCCAAATGA