Details for Arabidopsis Locus AT1G76670

Position : Chr1 ( 5`- 28772600 .. 28774901 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76670

Protein [Map View]
MEKPESEKKSAVSDVGAWAMNVISSVGIIMANKQLMSSSGFGFGFATTLTGFHFAFTALVGMVSNATGLSASKHVPLWEL
LWFSIVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCVLEWILHSKHYCKEVKASVMVVVIGVGICTVTDVKVNAKGFI
CACTAVFSTSLQQISIGSLQKKYSVGSFELLSKTAPIQAISLLICGPFVDYLLSGKFISTYQMTYGAIFCILLSCALAVF
CNISQYLCIGRFSATSFQVLGHMKTVCVLTLGWLLFDSEMTFKNIAGMAIAIVGMVIYSWAVDIEKQRNAKSTPHGKHSM
TEDEIKLLKEGVEHIDLKDVELGDTKP*

DNA
ATGGAGAAACCGGAGAGCGAGAAGAAATCGGCGGTGTCTGATGTCGGTGCATGGGCTATGAATGTAATCAGCTCCGTTGG
AATCATCATGGCTAATAAACAGCTCATGTCTTCCTCTGGTTTCGGTTTTGGCTTTGCTACAACGTTAACGGGATTTCACT
TTGCATTCACTGCTCTTGTTGGTATGGTGTCAAACGCAACGGGACTATCAGCTTCTAAGCATGTTCCTCTTTGGGAGCTT
CTCTGGTTCTCAATTGTTGCTAATATCTCTATCGCTGCTATGAACTTTAGTCTTATGCTCAACTCTGTTGGCTTCTATCA
GATTTCGAAATTGAGCATGATTCCGGTGGTATGCGTGTTGGAATGGATTCTACATAGCAAGCATTATTGTAAAGAAGTGA
AAGCTTCTGTAATGGTTGTGGTTATCGGTGTTGGGATTTGTACTGTGACTGATGTCAAAGTTAATGCCAAAGGTTTCATT
TGTGCATGCACTGCCGTTTTCTCCACTTCTCTGCAGCAGATTTCTATAGGCTCTCTGCAGAAGAAGTACTCAGTAGGATC
CTTTGAATTGCTGAGCAAAACTGCACCAATCCAAGCCATTTCACTTCTCATCTGTGGCCCCTTTGTTGACTATTTGTTGA
GCGGCAAATTCATATCTACTTACCAGATGACTTATGGTGCCATCTTCTGCATTCTTCTCTCCTGTGCATTAGCCGTTTTC
TGTAACATAAGCCAATATCTCTGCATCGGAAGATTCTCAGCGACATCTTTCCAAGTTCTAGGCCACATGAAAACAGTATG
CGTCCTCACATTAGGATGGCTTCTCTTTGATTCCGAGATGACATTCAAGAACATCGCCGGGATGGCCATAGCCATTGTTG
GAATGGTGATCTATAGTTGGGCTGTTGATATAGAGAAACAGAGGAACGCAAAGTCAACGCCACACGGCAAACACAGTATG
ACCGAAGATGAGATTAAGCTACTCAAAGAAGGAGTTGAGCATATCGACTTGAAAGACGTTGAACTCGGTGACACTAAACC
ATAA