Details for Arabidopsis Locus AT1G76620

Position : Chr1 ( 5`- 28756521 .. 28759297 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76620

Protein [Map View]
MMALMNCAYSSSSSSSSTSSPTSSSSSSSYSPRNRESMFLQSVVDASPSSFSSDRKSILPIEKTLIRHQNSSLCLIPKSS
EELKKEIASIEIEILHMERYLLSLYRKSFEQQLPNSFSNLSVTTTLPRSVTTSPTSLTHYQAYQKPISYPRSFNTSLKAL
SSREGTRVVSGTHSLGELLGSSHIVDHNNFINPNKLSEDIMRCISSVYCTLSRGSTSTTSTCFPASPVSSNASTIFSSKF
NYEDKWSLNGASEDHFLNHCQDQDNVLPCGVVVIEALRVHLDDGSFGYAALMLQNFRSLVQNLEKVDPSRMKREEKLAFW
INIHNALVMHAYLAYGTHNRARNTSVLKAAYDIGGYRINPYIIQSSILGIRPHYTSPSPLLQTLFSPSRKSKTCSVRHIY
ALEYPEALAHFAISSGAFTDPTVRVYTADRIFRDLRQAKQEYIRSNVRVYKGTKILLPKIFQHYVKDMSMDVSKLMEATS
QCLPEDARKIAEKCLKEKKSKNFEWLPENLSFRYVIAGELVGARNKT*

DNA
ATGATGGCTCTGATGAATTGTGCATATTCATCTTCTTCTTCGTCTTCGTCTACTTCCTCTCCCACTTCTTCATCATCTTC
TTCTTCATATTCTCCAAGGAACAGAGAGAGCATGTTTTTGCAGAGTGTAGTTGATGCGTCACCTTCAAGTTTCTCTTCCG
ACAGAAAATCTATTTTACCAATTGAGAAGACTTTAATAAGACATCAGAATTCCAGTCTCTGCTTGATCCCAAAGTCTTCA
GAAGAATTGAAGAAGGAGATTGCATCAATTGAGATAGAGATTCTACACATGGAACGATATCTCTTATCTCTTTACAGAAA
ATCATTTGAGCAACAACTTCCTAATTCCTTCTCTAATCTCTCTGTTACTACTACCTTACCTCGTTCTGTGACTACTTCAC
CAACATCACTAACTCATTATCAAGCTTACCAAAAACCAATCTCATATCCTCGGAGTTTCAACACTAGTTTAAAAGCCTTA
TCTTCAAGGGAAGGGACTAGAGTAGTTTCTGGTACTCACAGTCTTGGAGAGCTTTTAGGATCATCTCATATAGTTGATCA
TAACAACTTCATAAACCCGAATAAACTCTCTGAAGATATCATGAGATGCATTTCTTCTGTGTATTGTACACTTTCAAGAG
GATCAACGAGTACCACTTCCACTTGTTTTCCTGCTTCTCCGGTTTCCTCCAATGCCTCAACCATTTTCTCTTCCAAATTT
AATTATGAAGATAAATGGAGCTTGAATGGCGCAAGTGAGGATCATTTTCTGAATCACTGTCAAGATCAAGACAATGTTTT
GCCTTGTGGTGTTGTTGTCATAGAGGCTCTTAGAGTACATTTAGACGATGGTAGTTTCGGTTACGCTGCTCTTATGCTTC
AAAACTTCAGATCACTGGTTCAAAATCTTGAGAAAGTTGATCCGAGTAGAATGAAACGCGAAGAGAAGCTCGCGTTTTGG
ATAAACATTCACAATGCTCTTGTGATGCATGCTTACTTAGCTTATGGAACTCACAACCGCGCAAGAAACACATCGGTTTT
GAAGGCAGCTTATGATATTGGAGGCTATAGAATAAACCCTTATATCATCCAAAGCTCAATCTTAGGAATCAGACCTCATT
ACACATCACCATCACCTTTACTCCAAACTCTGTTTTCCCCTTCAAGAAAGTCGAAAACTTGCAGTGTTAGACACATTTAC
GCATTGGAATACCCCGAGGCTTTAGCTCATTTCGCTATTTCTTCAGGGGCATTCACTGATCCTACAGTTCGAGTTTACAC
CGCGGATAGAATCTTCCGGGATCTAAGACAAGCGAAACAAGAGTATATCAGAAGTAATGTTCGTGTTTACAAAGGGACAA
AGATTTTGTTGCCAAAGATCTTTCAACATTATGTTAAAGACATGTCAATGGATGTGTCTAAGCTCATGGAAGCAACATCT
CAATGTTTACCAGAAGATGCAAGGAAAATTGCTGAGAAATGTTTGAAAGAGAAGAAGAGTAAGAATTTTGAATGGTTACC
GGAAAATTTGAGCTTCCGGTATGTTATCGCCGGAGAATTGGTCGGAGCAAGAAATAAGACGTGA