Details for Arabidopsis Locus AT1G76590

Position : Chr1 ( 5`- 28740691 .. 28742207 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76590

Protein [Map View]
MGPMMMRAEEDNYNLNPPPWLIPMLRANYFIPCSIHAASNKSECNMFCLDCSSEAFCSYCLLNHRNHRVLQIRRSSYHNV
VRVNEIQKYIDISCVQTYIINSARIVFLNERPQPRIGKGVTNTCEICCRSLLDSFRFCSLGCKLGGMKRDPSLTFSLRGK
HGREYEGEWESDEATTPTKIRKTCAFNRLMSGLSISTVKCDYLSGDQPSSSSGDESGFKLSPGTPPIYNHRNSSRRKGVP
HRAPF*

DNA
ATGGGACCGATGATGATGAGAGCAGAAGAAGATAACTACAATCTAAATCCTCCACCATGGCTAATCCCAATGCTAAGAGC
AAACTACTTCATCCCTTGTTCAATCCACGCCGCTTCCAACAAAAGCGAGTGCAACATGTTCTGTCTTGACTGTTCTTCTG
AGGCCTTTTGCTCTTACTGTTTGCTCAATCACAGAAACCATCGTGTCCTCCAGATACGGAGATCATCGTACCACAACGTT
GTGAGAGTAAACGAGATTCAGAAGTACATAGACATATCTTGTGTTCAGACATATATAATCAACAGCGCAAGGATCGTTTT
CTTGAACGAACGTCCTCAGCCAAGAATCGGCAAAGGAGTCACCAATACTTGTGAAATCTGTTGCAGAAGCCTTCTCGATT
CTTTCCGTTTCTGCTCTCTCGGTTGCAAACTTGGAGGAATGAAGCGTGATCCAAGTCTAACCTTCTCTTTGAGAGGGAAG
CATGGAAGAGAGTACGAAGGTGAGTGGGAATCTGATGAAGCGACTACACCAACTAAGATACGCAAGACATGTGCTTTCAA
CCGTCTGATGAGTGGTCTTTCCATCTCCACCGTTAAATGTGATTACTTGTCAGGAGATCAACCGTCTTCGAGCTCCGGTG
ATGAGAGCGGTTTTAAACTTTCTCCGGGGACACCGCCGATATATAATCACCGGAATTCAAGTAGACGGAAGGGCGTCCCA
CACCGTGCTCCTTTCTAA