Details for Arabidopsis Locus AT1G76510

Position : Chr1 ( 5`- 28708614 .. 28712952 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76510

Protein [Map View]
MMADTEMQEQDVPSGTKGVVEEPSELEKDLNSIERPKSPVPEDTTHTLDSDVHLSDAPIANQIEANEEVGGQNSVDGRNG
DVDQSEKKITSDGGQEETTLGESNPLKGDPSSPHVPEESVKKWKTWLLSDAEAREVDEAGAPQDQEAFIKEVEAFNKENF
LEFKAPKFYGQPLNCLKLWRAVIKLGGYDVVTTSKLWRQVGESFHPPKTCTTVSWTFRIFYEKVNFIFGLSTEYALILMR
LYLFSLALLEYEKHLRQNGELNLPGSASLPSSGIEKEASSHQASGSGRTRRDAAARAMQGWHSQRLLGSGEVTEPIVKEK
GLNSTPKQKNLKNIGVQKQKTTTGMDLVFSHESEKQSTAEVIDVGPPADWVKINVRETKDCFEIFALVPGLLREEVRVQS
DPAGRLVIAGQPEQLDNPWGITPFKKVVNFPARIDPLHTSAVVSLHGRLFVRVPFEHREMNIDVPYKVSKEAVPYTFKYA
TNNHSVWYISFRK*

DNA
ATGATGGCGGATACTGAAATGCAAGAGCAAGATGTGCCGTCTGGTACCAAAGGTGTTGTAGAGGAGCCTTCAGAACTAGA
GAAAGACCTAAACTCTATTGAAAGACCTAAGTCCCCTGTTCCAGAGGATACGACTCATACTTTGGATAGTGATGTTCATT
TATCTGATGCTCCCATTGCTAATCAAATTGAGGCTAATGAAGAGGTTGGTGGTCAGAACAGTGTTGATGGGAGGAATGGT
GATGTTGATCAGTCTGAAAAGAAGATTACTAGTGATGGCGGTCAAGAGGAGACAACACTTGGGGAATCAAATCCTTTGAA
GGGGGATCCGTCGAGTCCTCATGTTCCTGAAGAAAGTGTTAAGAAGTGGAAGACATGGTTGTTGAGTGATGCTGAGGCCA
GGGAAGTTGATGAAGCAGGGGCACCACAGGATCAAGAGGCGTTTATTAAAGAAGTGGAGGCCTTCAACAAGGAGAATTTC
CTGGAATTTAAAGCCCCAAAGTTTTACGGACAGCCCTTAAATTGTCTCAAGCTTTGGAGAGCCGTTATCAAGTTAGGTGG
CTACGATGTGGTCACCACATCTAAGCTATGGCGGCAAGTTGGAGAATCGTTCCATCCTCCAAAAACATGCACTACAGTCT
CCTGGACATTCCGCATTTTCTATGAAAAGGTGAATTTCATTTTTGGTCTAAGTACTGAATATGCATTGATATTAATGAGG
TTGTACTTGTTCAGTTTAGCACTTTTGGAGTATGAGAAGCATTTAAGGCAAAATGGTGAGCTTAACCTTCCTGGTTCAGC
TTCTCTTCCGTCTTCAGGCATTGAAAAGGAGGCAAGTAGCCATCAAGCTTCAGGGTCAGGCAGAACAAGAAGAGATGCTG
CAGCTCGTGCTATGCAAGGTTGGCATTCTCAGCGCCTTCTTGGATCTGGGGAGGTTACTGAGCCTATTGTTAAGGAGAAA
GGCTTGAATTCAACCCCAAAGCAAAAGAACCTCAAAAACATTGGTGTGCAGAAACAAAAAACAACAACCGGCATGGACCT
TGTTTTTTCACACGAATCAGAAAAACAGTCAACTGCCGAGGTTATAGATGTTGGACCCCCTGCAGACTGGGTGAAGATCA
ATGTCAGAGAAACTAAAGACTGCTTTGAGATATTTGCCCTGGTACCTGGACTTCTTCGCGAAGAGGTCCGTGTTCAGTCA
GACCCTGCAGGGCGGCTAGTTATAGCAGGCCAACCTGAGCAACTTGACAATCCTTGGGGAATCACACCCTTCAAAAAGGT
TGTGAACTTTCCCGCAAGAATCGATCCGCTGCACACGTCAGCGGTTGTGAGCCTGCATGGTCGACTGTTTGTGCGAGTCC
CATTTGAGCATAGAGAAATGAATATTGATGTTCCATATAAAGTTAGTAAGGAAGCTGTTCCTTATACCTTCAAGTATGCA
ACCAACAATCACAGTGTCTGGTATATATCTTTTAGAAAATGA