Details for Arabidopsis Locus AT1G76490

Position : Chr1 ( 5`- 28695760 .. 28698793 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76490

Protein [Map View]
MKKKQAGPQQTCEFVSYKTLLISPSHLSRHLTTSLLSPLSPPWRDYSFPPMDLRRRPPKPPVTNNNNSNGSFRSYQPRTS
DDDHRRRATTIAPPPKASDALPLPLYLTNAVFFTLFFSVAYYLLHRWRDKIRYNTPLHVVTITELGAIIALIASFIYLLG
FFGIDFVQSFISRASGDAWDLADTIDDDDHRLVTCSPPTPIVSVAKLPNPEPIVTESLPEEDEEIVKSVIDGVIPSYSLE
SRLGDCKRAASIRREALQRVTGRSIEGLPLDGFDYESILGQCCEMPVGYIQIPVGIAGPLLLDGYEYSVPMATTEGCLVA
STNRGCKAMFISGGATSTVLKDGMTRAPVVRFASARRASELKFFLENPENFDTLAVVFNRSSRFARLQSVKCTIAGKNAY
VRFCCSTGDAMGMNMVSKGVQNVLEYLTDDFPDMDVIGISGNFCSDKKPAAVNWIEGRGKSVVCEAVIRGEIVNKVLKTS
VAALVELNMLKNLAGSAVAGSLGGFNAHASNIVSAVFIATGQDPAQNVESSQCITMMEAINDGKDIHISVTMPSIEVGTV
GGGTQLASQSACLNLLGVKGASTESPGMNARRLATIVAGAVLAGELSLMSAIAAGQLVRSHMKYNRSSRDISGATTTTTT
TT*

DNA
ATGAAGAAAAAGCAAGCTGGTCCCCAACAGACATGCGAGTTCGTCTCCTATAAAACTTTGTTAATCTCTCCTTCACACTT
ATCACGCCACCTCACCACCTCTCTCCTCTCTCCTCTCTCTCCCCCCTGGAGAGATTATTCATTCCCTCCAATGGATCTCC
GTCGGAGGCCTCCTAAACCACCGGTTACCAACAACAACAACTCCAACGGATCTTTCCGTTCTTATCAGCCTCGCACTTCC
GATGACGATCATCGTCGCCGGGCTACAACAATTGCTCCTCCACCGAAAGCATCCGACGCGCTTCCTCTTCCGTTATATCT
CACAAACGCCGTTTTCTTCACGCTCTTCTTCTCCGTCGCGTATTACCTCCTCCACCGGTGGCGTGACAAGATCCGTTACA
ATACGCCTCTTCACGTCGTCACTATCACAGAACTCGGCGCCATTATTGCTCTCATCGCTTCGTTTATCTATCTCCTAGGG
TTTTTTGGTATTGACTTTGTTCAGTCATTTATCTCACGTGCCTCTGGTGATGCTTGGGATCTCGCCGATACGATCGATGA
TGATGACCACCGCCTTGTCACGTGCTCTCCACCGACTCCGATCGTTTCCGTTGCTAAATTACCTAATCCGGAACCTATTG
TTACCGAATCGCTTCCTGAGGAAGACGAGGAGATTGTGAAATCGGTTATCGACGGAGTTATTCCATCGTACTCGCTTGAA
TCTCGTCTCGGTGATTGCAAAAGAGCGGCGTCGATTCGTCGTGAGGCGTTGCAGAGAGTCACCGGGAGATCGATTGAAGG
GTTACCGTTGGATGGATTTGATTATGAATCGATTTTGGGGCAATGCTGTGAGATGCCTGTTGGATACATTCAGATTCCTG
TTGGGATTGCTGGTCCATTGTTGCTTGATGGTTATGAGTACTCTGTTCCTATGGCTACAACCGAAGGTTGTTTGGTTGCT
AGCACTAACAGAGGCTGCAAGGCTATGTTTATCTCTGGTGGCGCCACCAGTACCGTTCTTAAGGACGGTATGACCCGAGC
ACCTGTTGTTCGGTTCGCTTCGGCGAGACGAGCTTCGGAGCTTAAGTTTTTCTTGGAGAATCCAGAGAACTTTGATACTT
TGGCAGTAGTCTTCAACAGGTCGAGTAGATTTGCAAGACTGCAAAGTGTTAAATGCACAATCGCGGGGAAGAATGCTTAT
GTAAGGTTCTGTTGTAGTACTGGTGATGCTATGGGGATGAATATGGTTTCTAAAGGTGTGCAGAATGTTCTTGAGTATCT
TACCGATGATTTCCCTGACATGGATGTGATTGGAATCTCTGGTAACTTCTGTTCGGACAAGAAACCTGCTGCTGTGAACT
GGATTGAGGGACGTGGTAAATCAGTTGTTTGCGAGGCTGTAATCAGAGGAGAGATCGTGAACAAGGTCTTGAAAACGAGC
GTGGCTGCTTTAGTCGAGCTCAACATGCTCAAGAACCTAGCTGGCTCTGCTGTTGCAGGCTCTCTAGGTGGATTCAACGC
TCATGCCAGTAACATAGTGTCTGCTGTATTCATAGCTACTGGCCAAGATCCAGCTCAAAACGTGGAGAGTTCTCAATGCA
TCACCATGATGGAAGCTATTAATGACGGCAAAGATATCCATATCTCAGTCACTATGCCATCTATCGAGGTGGGGACAGTG
GGAGGAGGAACACAGCTTGCATCTCAATCAGCGTGTTTAAACCTGCTCGGAGTTAAAGGAGCAAGCACAGAGTCGCCGGG
AATGAACGCAAGGAGGCTAGCGACGATCGTAGCCGGAGCAGTTTTAGCTGGAGAGTTATCTTTAATGTCAGCAATTGCAG
CTGGACAGCTTGTGAGAAGTCACATGAAATACAATAGATCCAGCCGAGACATCTCTGGAGCAACGACAACGACAACAACA
ACAACATGA