Details for Arabidopsis Locus AT1G76470

Position : Chr1 ( 5`- 28689770 .. 28691449 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76470

Protein [Map View]
MAVKQKVCVTGAGGFIASWLVKFLLSRGYTVHGTVRDPCDEKNDHLRKLDNASKNLKLFKADLFDDEGLFSAIDGCSGVF
HIASPVPFEGVPLTEEELIKPALTGTKNVLEACTETKVQKVVVVSSIAAVVYNPKWPQDVAKDEDCWSDTQYLHSLEGYW
RYYYLAKTLTEREALEWSKRNFADVVTLCPSVIIGPRLQSTLNSSSLGLLKFIKGGIKSLLSDELYLVDVRDVADALLLV
YENREATGRYICNSHSLYTDSLMEKLKNMYPKRNFPESFTEVKEKEVRPLSAEKLKNLGWKFRPLEETIDDSVVSFEAAG
DLPKA*

DNA
ATGGCTGTAAAGCAAAAGGTCTGTGTTACTGGTGCAGGAGGGTTTATTGCTTCATGGCTCGTCAAGTTTCTTCTCTCTCG
TGGCTACACTGTCCATGGAACCGTTCGAGATCCTTGTGATGAAAAGAATGACCATTTGAGGAAACTGGATAATGCTTCAA
AAAATCTGAAACTTTTCAAGGCAGATTTGTTTGATGATGAAGGTCTTTTCTCAGCCATTGATGGTTGCTCTGGCGTTTTC
CATATCGCTTCTCCTGTGCCTTTTGAAGGAGTTCCTCTCACAGAGGAAGAACTGATTAAACCAGCTCTCACTGGCACCAA
GAATGTTCTAGAAGCATGCACAGAAACCAAAGTGCAGAAAGTTGTGGTTGTATCATCAATCGCTGCAGTTGTTTACAATC
CAAAATGGCCTCAAGATGTTGCTAAGGACGAGGATTGTTGGTCAGACACTCAATACCTTCACTCACTTGAGGGTTATTGG
CGTTATTACTATCTTGCCAAAACATTAACGGAACGTGAAGCTTTAGAGTGGAGTAAGAGAAACTTTGCTGATGTTGTTAC
GCTCTGTCCGTCTGTCATTATAGGCCCTAGGCTTCAATCCACGCTTAACTCTAGTAGTTTGGGACTTCTCAAGTTCATAA
AAGGTGGTATAAAGTCCTTGTTGAGCGATGAACTGTATCTTGTGGATGTGCGTGATGTTGCGGATGCGCTTTTGTTGGTG
TATGAAAATCGAGAAGCAACAGGAAGATACATATGTAATTCTCATTCACTTTACACTGATTCTCTTATGGAGAAGCTCAA
GAATATGTATCCTAAACGCAACTTCCCTGAAAGTTTCACGGAGGTAAAAGAGAAGGAAGTGAGGCCTCTAAGTGCAGAGA
AGTTGAAAAACTTGGGGTGGAAGTTTAGGCCATTAGAAGAAACCATTGATGATTCTGTTGTGAGCTTTGAAGCAGCTGGT
GATCTTCCAAAGGCATAA