Details for Arabidopsis Locus AT1G76450

Position : Chr1 ( 5`- 28684551 .. 28686244 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76450

Protein [Map View]
MAAISPWLSSPQSFSNPRVTITDSRRCSSISAAISVLDSSNEEQHRISSRDHVGMKRRDVMLQIASSVFFLPLAISPAFA
ETNASEAFRVYTDETNKFEISIPQDWQVGQAEPNGFKSITAFYPQETSTSNVSIAITGLGPDFTRMESFGKVEAFAETLV
SGLDRSWQKPVGVTAKLIDSRASKGFYYIEYTLQNPGEARKHLYSAIGMATNGWYNRLYTVTGQFTDEESAEQSSKIQKT
VKSFRFI*

DNA
ATGGCAGCGATTTCTCCATGGTTATCTTCTCCTCAGAGCTTTTCGAATCCCCGCGTTACCATTACAGATTCCAGAAGATG
TTCATCAATTTCTGCGGCAATCTCTGTTCTTGACAGCTCCAACGAGGAACAACATCGAATTTCGTCTAGAGATCATGTTG
GGATGAAGAGAAGAGACGTCATGTTACAGATAGCTTCCTCTGTTTTCTTCCTTCCATTGGCCATTTCACCTGCATTTGCA
GAGACAAATGCATCAGAAGCTTTCCGTGTGTACACAGATGAAACGAACAAATTCGAGATATCAATCCCACAAGATTGGCA
AGTCGGGCAAGCAGAACCTAATGGATTCAAGTCAATCACAGCTTTTTACCCACAAGAAACTTCAACTTCCAATGTGAGTA
TAGCGATCACTGGACTAGGTCCAGACTTCACCAGGATGGAATCATTCGGAAAGGTCGAAGCTTTCGCCGAAACATTGGTC
AGTGGATTGGATAGAAGCTGGCAAAAACCAGTAGGAGTGACTGCAAAGCTAATCGATAGCAGAGCTTCTAAGGGATTCTA
TTACATCGAGTACACCTTACAAAACCCTGGAGAAGCTCGCAAGCATTTGTACTCTGCAATTGGAATGGCAACAAACGGAT
GGTACAACCGTTTATACACTGTCACAGGACAGTTTACAGATGAAGAATCTGCTGAACAAAGCTCTAAGATCCAGAAGACA
GTCAAGTCTTTCAGATTCATCTGA