Details for Arabidopsis Locus AT1G76420

Position : Chr1 ( 5`- 28672029 .. 28673934 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76420

Protein [Map View]
MMLAVEDVLSELAGEERNERGLPPGFRFHPTDEELITFYLASKIFHGGLSGIHISEVDLNRCEPWELPEMAKMGEREWYF
YSLRDRKYPTGLRTNRATTAGYWKATGKDKEVFSGGGGQLVGMKKTLVFYKGRAPRGLKTKWVMHEYRLENDHSHRHTCK
EEWVICRVFNKTGDRKNVGLIHNQISYLHNHSLSTTHHHHHEALPLLIEPSNKTLTNFPSLLYDDPHQNYNNNNFLHGSS
GHNIDELKALINPVVSQLNGIIFPSGNNNNDEDDFDFNLGVKTEQSSNGNEIDVRDYLENPLFQEASYGLLGFSSSPGPL
HMLLDSPCPLGFQL*

DNA
ATGATGCTTGCGGTGGAAGATGTGTTAAGCGAACTCGCCGGAGAAGAAAGGAACGAGAGAGGATTGCCACCTGGCTTCCG
GTTTCACCCGACGGACGAAGAGCTCATTACCTTCTACTTAGCTTCCAAAATCTTCCATGGTGGTCTCTCCGGCATTCACA
TTTCCGAAGTTGATCTCAACCGCTGTGAACCTTGGGAGCTACCAGAAATGGCGAAGATGGGAGAGAGAGAGTGGTACTTT
TATAGTCTAAGGGACAGGAAATATCCGACAGGTTTGAGGACTAACAGAGCAACTACTGCTGGATACTGGAAAGCTACCGG
CAAAGATAAGGAAGTCTTCTCCGGCGGAGGAGGACAGCTTGTTGGGATGAAGAAGACGTTGGTGTTCTACAAAGGTAGGG
CTCCACGTGGCCTCAAGACTAAGTGGGTCATGCATGAGTATCGCCTCGAAAACGACCATTCACACCGCCACACGTGTAAG
GAGGAATGGGTGATTTGCAGAGTGTTCAATAAAACAGGAGACAGAAAAAATGTTGGATTAATCCATAACCAAATCAGCTA
CCTTCATAACCATTCACTCTCAACAACACATCATCATCATCATGAAGCCTTACCTTTGCTTATAGAACCTTCCAACAAAA
CCCTAACCAACTTCCCATCACTACTCTACGATGATCCACACCAAAACTACAATAATAACAACTTCCTTCATGGATCATCA
GGCCACAACATCGACGAGCTCAAAGCCTTAATCAACCCTGTCGTCTCTCAGCTCAACGGTATCATCTTTCCTTCAGGGAA
CAACAACAACGACGAAGACGACTTCGACTTTAACCTCGGCGTGAAAACAGAGCAGTCTTCGAACGGTAACGAAATTGACG
TACGAGATTACTTGGAGAACCCTCTGTTTCAGGAAGCGAGTTATGGTCTGTTGGGTTTTTCGTCTTCTCCTGGACCTCTT
CACATGCTACTAGATTCTCCATGTCCTTTAGGATTCCAGCTGTAG