Details for Arabidopsis Locus AT1G76405

Position : Chr1 ( 5`- 28661884 .. 28663789 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76405

Protein [Map View]
METSMRYTSNSKSMKIHAKEKVPVNSKTHLQLHGELDTGTGAPSYFCAMIRHFFPEASTGLGVGLHYDKRQKLRCLVRGK
KEFPVRADKRVTFNIKGRCDIDQDLNQKNPKGAAEFAWNIMDFKEDQDVRIKVGYEMFDKVPYMQIRENNWTLNANMKGK
WNLRYDL*

DNA
ATGGAGACTTCTATGAGGTATACCAGCAATTCCAAGTCTATGAAGATTCATGCCAAAGAGAAGGTTCCGGTGAACTCAAA
AACCCATTTACAGCTTCATGGAGAGTTAGATACTGGAACTGGGGCTCCGAGTTACTTCTGTGCGATGATTAGACACTTTT
TTCCTGAGGCTTCAACAGGCCTTGGGGTAGGATTGCATTATGATAAGCGCCAAAAGCTTCGGTGTCTTGTACGCGGAAAA
AAAGAGTTTCCTGTAAGAGCTGATAAGCGTGTAACCTTTAATATTAAAGGGCGGTGTGATATTGATCAGGACTTAAATCA
GAAGAACCCCAAAGGAGCAGCAGAATTTGCCTGGAACATAATGGATTTCAAGGAAGATCAGGATGTACGGATCAAAGTTG
GCTACGAAATGTTTGATAAGGTCCCTTATATGCAGATTAGAGAAAACAATTGGACTCTCAACGCGAACATGAAGGGAAAA
TGGAACTTGCGGTATGACCTGTAA