Details for Arabidopsis Locus AT1G76390

Position : Chr1 ( 5`- 28655390 .. 28658711 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76390

Protein [Map View]
MAGSGSWDGSQSDNSSQFEPGIDNIYEAFICPLTKQVMHNPVTLENGQTFEREAIEKWFQECRENGQPLSCPITSKELSI
TDLSPSIALRNTIEEWRARNDALKLDIARQSLYLGNAETNILLALKNVREICRNIRKIRQRVCNPQLVRLITDMLKSSSH
EVRCKALQTLQVVVEGDEESKAIVAEGDTVRTIVKFLSQEPSKGREAAVSVLFELSKSEALCEKIGSIHGAIILLVGLTS
SKSENVSTVEKADKTLTNLERSEENVRQMAINGRLQPLLAKLLEGSPETKVSMAFYLGVLALNNDVKVIVAQTVGSSLID
LMRTRDMSQREAALGALNNISSFEGSAKLLINTGILPPLIKDLFYVGPNQLPIRLKEVSATILANIVNIGYDFDKVPVGP
HHQTLVSEEIVENLLQLTSNTGPEIQGKLLAVLVGLTSCPNSVINVVSAIRNSAAIISLVQFVEIHENDDLRLASIKLLH
NISPHMSEELANALRSTVGQLGSLVSIISENTPTITEEQAAAAGLLAELPERDLVLTMRLLREGAFEKIISKIVGIRQGE
IRGIRFERTFLEGLVSILARITFALTKETDATLFCCEKNLPSLFLDLLQSNSQDNIQRASATALENLSLESKNLTKIPEL
PPPTYCVSIFSCLSKPPVVLGICKIHQGICSVRESFCLVEGQAVDKLVDLLDHENDKVVGPALAALSTLLEDGLDVVQGV
RLIDEADGITPILNVLLENRTENLRIRAVWMVERILRIEEIAREVGEEQNVTAALVDAFQNADFRTRQIAEKALRHIDKI
PNFSGIFTNIG*

DNA
ATGGCTGGAAGTGGAAGTTGGGATGGAAGCCAATCGGATAACAGCTCACAATTCGAGCCAGGGATTGATAACATATACGA
AGCTTTTATCTGTCCATTGACAAAGCAAGTTATGCATAATCCTGTCACTTTAGAGAATGGTCAGACATTTGAGCGTGAAG
CTATTGAGAAATGGTTTCAAGAATGTCGTGAAAACGGTCAACCTCTATCTTGTCCTATAACTTCTAAGGAGTTGAGTATC
ACTGATCTAAGTCCAAGTATAGCTTTACGTAACACTATTGAAGAGTGGAGAGCAAGGAATGATGCTTTGAAGCTTGATAT
TGCTCGTCAGTCACTTTATTTGGGAAATGCTGAGACTAATATTTTGCTGGCTTTGAAGAATGTCAGAGAGATTTGTAGGA
ATATACGTAAAATTAGGCAACGTGTGTGCAATCCTCAGCTTGTTCGGTTGATTACCGATATGCTAAAGAGTAGTAGTCAT
GAAGTGCGGTGTAAGGCTCTACAAACTCTTCAAGTAGTCGTTGAAGGAGATGAAGAGAGCAAGGCAATAGTAGCTGAAGG
AGACACTGTGCGTACTATAGTTAAGTTCTTGTCTCAAGAGCCATCAAAGGGGAGGGAAGCAGCTGTTTCCGTGTTGTTTG
AGCTCTCTAAATCTGAAGCATTATGCGAGAAGATTGGATCAATCCATGGAGCAATCATCTTATTGGTTGGTCTGACAAGC
AGCAAATCAGAGAATGTTTCAACTGTTGAGAAAGCTGATAAAACTTTGACAAATTTGGAGAGGTCAGAGGAAAATGTTCG
ACAGATGGCTATCAATGGTAGACTGCAGCCTCTTCTTGCTAAACTTCTTGAAGGTTCACCGGAAACAAAAGTTTCCATGG
CTTTCTATCTTGGGGTTCTTGCTTTAAATAACGATGTGAAAGTTATTGTGGCTCAGACTGTGGGTTCTTCTCTTATCGAT
CTTATGAGAACTCGCGACATGAGCCAACGGGAAGCTGCTTTGGGAGCTCTTAACAACATCTCATCCTTTGAAGGGAGTGC
TAAACTCTTAATCAACACCGGAATTCTCCCACCGCTTATCAAAGACTTGTTCTATGTTGGGCCAAACCAGCTTCCAATCC
GACTTAAAGAAGTCTCTGCAACTATTCTTGCCAATATAGTGAACATTGGGTACGACTTCGACAAAGTTCCTGTTGGACCT
CATCACCAAACTCTTGTTTCAGAGGAAATAGTGGAGAACCTTCTCCAACTAACAAGCAACACTGGTCCAGAAATCCAAGG
AAAGCTGTTGGCGGTTCTTGTTGGACTCACTAGCTGTCCAAACTCGGTTATTAATGTTGTTTCTGCCATCAGAAACTCAG
CTGCCATCATAAGCTTGGTTCAGTTTGTTGAGATACATGAGAACGATGATTTGCGGTTAGCTTCTATCAAGCTTCTTCAT
AACATTTCCCCACACATGAGTGAAGAACTAGCCAATGCGTTGCGTAGCACTGTTGGACAGCTCGGAAGCCTTGTTTCGAT
CATATCAGAGAATACACCAACAATCACTGAGGAACAAGCTGCAGCTGCTGGACTTTTAGCTGAACTTCCTGAGAGAGATT
TGGTTCTGACAATGAGATTGTTAAGAGAAGGTGCTTTTGAGAAAATCATCTCCAAGATAGTTGGTATTCGCCAAGGAGAA
ATCAGAGGAATCCGGTTCGAGAGAACATTTCTCGAAGGACTTGTTAGTATTCTCGCTCGGATCACCTTCGCACTCACCAA
GGAGACTGACGCCACTTTGTTCTGCTGTGAGAAAAATCTTCCTTCACTTTTCCTTGATCTCCTTCAATCCAACAGTCAAG
ATAACATCCAGAGGGCTTCTGCAACAGCATTGGAGAATCTTTCACTTGAATCCAAAAATCTTACAAAGATACCTGAACTG
CCTCCTCCTACTTACTGTGTATCCATCTTTTCATGTCTGAGCAAACCGCCTGTTGTTCTAGGGATTTGCAAGATCCATCA
AGGGATATGTTCAGTAAGAGAAAGCTTTTGTCTCGTTGAAGGACAAGCAGTAGATAAGTTGGTTGATCTCTTAGACCATG
AAAATGACAAGGTGGTTGGACCAGCACTTGCAGCTCTCTCTACATTGTTAGAGGACGGTTTAGATGTTGTACAAGGAGTG
AGATTAATTGATGAAGCAGACGGGATTACGCCTATATTAAATGTTCTTTTGGAGAATCGAACAGAGAATTTAAGGATTAG
AGCTGTGTGGATGGTCGAGAGGATCTTACGTATTGAAGAAATAGCTAGAGAAGTGGGAGAAGAACAAAATGTAACTGCAG
CACTTGTGGACGCCTTTCAAAACGCCGATTTTAGGACACGACAGATTGCAGAGAAGGCGTTGAGGCACATCGACAAAATC
CCAAACTTCTCTGGTATATTCACCAACATTGGTTAG