Details for Arabidopsis Locus AT1G76380

Position : Chr1 ( 5`- 28651154 .. 28654580 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76380

Protein [Map View]
MGEVADNNTLMKRKKKGRPSLLDLQKRALKQQQLLQRRNPNEENEEELRSSSRNPNFSNRSNRRRNSNSEDDDDERRDKK
HRLLHGLNSHEGRDSSNSKSGGGDLDSDARNRRKIDGSDNTGEKASKATDILLQRGSLVESTPLPDKKLLFFILDRVQKK
DTYGVYSDPADPEELPDYYEIIKNPMDFTTLRKKLESGAYTTLEQFEQDVFLICTNAMEYNSADTVYYRQARAMLELAKK
DFGNLRQESDGEEPVSLSQQPKVVKRGRPPGSGLKKQLEQSLIDRTTSDISADAAAFTYAGDSSRLSGSYNLRKNPPSYG
FRHAETSVRINHNSENQSGLLIDWEKEFPPSVVKAVNKYGMKNVDENRRDTYNQNSASLQDSSIFTLLDDNLKQLTPVGL
KAEYGYARSLARYAANIGPVAWTFANVRIEKLLPTGTEFGPGWVGENPENPPQQQNLMSGKQKCSNDYASDDHHQSSRIM
SPSTSVSSSIIGNIHSSHESKESVQVLNQETEINGLVRGSSGFNHKPNQMLETAGSQQGNIKQEFQRLPPDLNARLSSPN
SPGSNHQAGSSQHPDLALQL*

DNA
ATGGGTGAGGTAGCTGATAATAATACATTGATGAAGAGGAAGAAGAAAGGTAGGCCATCACTTCTTGACCTCCAAAAGCG
AGCTCTCAAACAGCAACAATTGCTTCAGAGAAGAAATCCCAATGAAGAAAACGAAGAAGAGCTTAGATCCAGTTCCAGAA
ACCCTAATTTCAGCAACCGATCAAATCGCCGGAGGAATTCAAATTCTGAAGACGACGACGATGAGAGGAGAGACAAAAAG
CATCGGCTTTTACACGGATTGAATTCACACGAGGGTCGTGATTCTTCTAATTCCAAATCTGGCGGCGGCGATTTGGACTC
CGATGCACGCAACCGCCGGAAAATTGACGGATCTGACAATACGGGAGAAAAGGCTTCGAAAGCGACAGACATTCTTCTTC
AAAGAGGGTCACTTGTGGAGTCTACACCTTTGCCAGACAAAAAGTTGTTGTTCTTCATTCTTGATAGAGTTCAAAAGAAG
GATACTTATGGAGTGTACTCTGATCCAGCTGATCCAGAGGAGCTTCCTGATTATTATGAGATTATCAAGAATCCGATGGA
TTTCACCACATTGCGGAAGAAATTAGAATCCGGGGCATACACCACCTTAGAACAATTTGAGCAAGACGTATTTTTAATAT
GTACGAATGCGATGGAGTACAATTCAGCAGATACAGTATACTACCGACAGGCAAGAGCTATGCTTGAGTTGGCGAAAAAG
GACTTTGGAAATTTGAGACAAGAAAGTGATGGAGAAGAACCAGTGTCACTGTCACAACAGCCGAAAGTAGTCAAAAGAGG
CCGTCCTCCAGGCTCAGGCCTTAAGAAACAGCTTGAGCAATCTTTGATTGATCGCACGACTTCTGATATTTCTGCTGATG
CAGCAGCATTCACTTATGCTGGAGATAGCTCTAGATTATCCGGTTCTTACAATCTAAGAAAAAATCCTCCTTCATATGGA
TTCCGTCATGCAGAAACTTCGGTTAGAATCAACCATAATAGCGAGAACCAAAGTGGCTTGTTGATAGATTGGGAGAAGGA
GTTTCCACCTTCTGTTGTGAAGGCTGTCAATAAATACGGGATGAAAAATGTCGACGAGAACAGGCGAGATACCTACAACC
AGAACTCTGCTTCCTTGCAAGATTCTTCGATTTTTACACTGCTTGATGATAATTTAAAACAATTAACTCCAGTTGGACTG
AAAGCTGAATATGGGTATGCTAGGAGTCTAGCACGGTATGCAGCAAATATTGGTCCTGTTGCTTGGACATTTGCCAATGT
AAGGATTGAAAAACTGTTACCAACTGGAACCGAATTTGGTCCCGGGTGGGTTGGAGAGAACCCTGAGAATCCTCCTCAAC
AGCAAAACTTAATGTCGGGAAAGCAAAAGTGTTCGAATGACTATGCATCTGATGATCATCATCAGTCAAGTAGAATCATG
TCTCCATCAACCTCTGTCTCAAGCTCCATCATAGGAAACATACATTCTTCCCATGAAAGCAAAGAGTCTGTTCAGGTATT
GAATCAAGAAACCGAGATAAATGGTCTAGTCCGTGGTTCCAGCGGATTTAACCATAAACCAAACCAGATGCTGGAAACAG
CTGGCTCGCAGCAAGGCAACATAAAACAGGAATTTCAGCGGTTGCCACCAGATCTCAATGCTAGGCTTTCCTCACCAAAC
TCACCAGGCTCTAACCACCAGGCAGGTTCATCGCAGCATCCGGATTTGGCGTTACAACTCTAA