Details for Arabidopsis Locus AT1G76360

Position : Chr1 ( 5`- 28643038 .. 28646712 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76360

Protein [Map View]
MGNICPGSGSSTVNHEPVSTKPLPVRRVQTPENKKFPPPLVAMPALHPTFPLPETGHKLRPAATPPREKPQHRTTRSVEN
PPREKPQEKTRSVENPPREKPQEKTRSVETPPQEKTRPVDNPPSKPVEKLGLGRKAVPPSGKIVTPNLKMFTLVELKTAT
KNFRPESVIGEGGFGQVFKGWVDEKTLAPSRAGVGIPVAVKKSNPDSEQGLHEWQCEVRFLGKFHHPNLVKLLGYCWEEN
QFLLVYEYLPKGSLENHLFSKGAEALPWDTRLKIAIEAAQGLTFLHNSEKSVIYRDFKASNILLDSNFHAKLSDFGLAKN
GPINGFSHVTTRVMGTQGYAAPEYMATGHLYVRSDVYGFGVVLLELLTGLRALDPNRPSAQQNLVEWAKPGLNQKKKVQK
MMDPRLEQKYPLLAVTKTAELILRCLEADPKNRPPMDDVLRELEVVRTIRDQPQEERRKRSSGPDTNRVRGNDSPYGRRT
GRTG*

DNA
ATGGGAAACATCTGTCCTGGCTCTGGATCTTCCACTGTTAACCACGAACCTGTCTCCACCAAACCCCTCCCAGTGAGACG
TGTGCAGACCCCAGAGAATAAAAAGTTTCCTCCGCCGCTGGTGGCGATGCCGGCGTTACATCCCACGTTTCCACTGCCGG
AAACAGGACATAAACTGAGACCCGCCGCTACCCCGCCTCGTGAAAAACCGCAACATAGGACGACGAGATCCGTCGAGAAC
CCACCTCGTGAAAAACCGCAGGAGAAGACAAGATCCGTCGAGAACCCGCCTCGTGAAAAACCGCAGGAGAAAACAAGATC
CGTTGAAACCCCACCTCAGGAGAAGACGAGACCCGTCGATAATCCGCCGTCAAAGCCGGTAGAAAAATTGGGTTTAGGAA
GGAAAGCAGTGCCACCGAGTGGGAAGATAGTGACACCTAATCTAAAGATGTTTACATTAGTGGAGCTTAAGACGGCTACA
AAGAACTTTCGACCAGAATCTGTGATCGGAGAAGGTGGATTCGGACAGGTTTTTAAAGGATGGGTGGATGAGAAAACATT
AGCTCCGTCGAGAGCTGGCGTCGGAATACCAGTCGCCGTCAAGAAATCAAACCCTGATAGTGAGCAAGGCTTACATGAAT
GGCAGTGTGAAGTGAGATTCTTAGGGAAGTTTCATCATCCAAATTTGGTGAAGCTCTTGGGTTATTGCTGGGAAGAGAAC
CAGTTCCTTTTGGTCTATGAGTATTTGCCTAAAGGAAGCCTTGAAAATCACCTCTTCTCAAAAGGAGCAGAGGCATTACC
TTGGGATACACGTTTGAAGATAGCCATTGAAGCAGCTCAAGGACTTACCTTTTTGCATAACTCCGAGAAGAGTGTTATCT
ATAGAGACTTCAAAGCTTCCAATATTCTTCTCGATTCCAACTTCCACGCCAAGCTTTCAGACTTCGGACTAGCTAAAAAT
GGGCCCATTAATGGATTCTCACACGTGACCACACGTGTCATGGGCACACAAGGCTATGCAGCTCCCGAGTACATGGCTAC
AGGTCATCTATATGTGAGGAGTGATGTTTACGGGTTTGGAGTGGTACTCTTAGAGCTCTTAACCGGTTTAAGAGCATTAG
ACCCAAACCGACCATCTGCGCAACAAAATCTTGTGGAATGGGCTAAACCGGGGTTGAACCAGAAGAAGAAGGTTCAGAAA
ATGATGGATCCACGGCTCGAGCAGAAGTATCCACTTTTGGCGGTGACCAAAACCGCGGAGCTCATTCTTCGGTGTCTGGA
GGCTGACCCGAAAAACCGACCGCCAATGGATGATGTGCTTAGAGAATTAGAAGTCGTAAGGACTATCAGAGACCAACCCC
AAGAAGAGAGGCGTAAAAGGAGCAGTGGTCCAGATACTAACCGGGTTCGTGGAAATGATTCACCATATGGCCGTAGAACC
GGTCGAACCGGATAG