Details for Arabidopsis Locus AT1G76300

Position : Chr1 ( 5`- 28625884 .. 28627367 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76300

Protein [Map View]
MSRSLGIPVKLLHESSGHIVSVEMKSGELYRGSMIECEDNWNCQLENITYTAKDGKVSQLEHVFIRGSLVRFLVIPDMLK
NAPMFKDVRGKGKSASLGVGRGRGAAMRAKGTGRGTGGGRGAVPPVRR*

DNA
ATGAGTCGGAGTTTGGGGATTCCGGTGAAGCTTCTTCACGAATCGTCCGGTCATATCGTGAGTGTAGAGATGAAGAGCGG
TGAGCTTTACAGAGGAAGCATGATCGAGTGTGAGGATAATTGGAACTGTCAGCTCGAGAACATCACCTATACGGCCAAGG
ATGGTAAGGTATCACAGCTTGAGCATGTCTTCATTCGAGGCAGCTTAGTCAGGTTTTTAGTCATACCAGACATGTTAAAG
AATGCTCCAATGTTCAAGGATGTTAGGGGCAAGGGAAAGAGCGCTTCACTAGGTGTAGGCAGAGGTAGAGGTGCTGCAAT
GCGAGCCAAAGGTACTGGGCGTGGAACAGGAGGAGGAAGAGGGGCTGTGCCACCTGTGAGGAGATAG