Details for Arabidopsis Locus AT1G76280

Position : Chr1 ( 5`- 28617639 .. 28622731 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76280

Protein [Map View]
MYRALWLSPLRFIVSSSSSKLTPYVSRGRGLSGIDNGAGCSCSRSVTTMIGNEFIRCQDESKILQLQIVDALRSGERQGA
SALLFKLIQGNYSLSADDFHDILYYCARSPDPVTYSVMCKKEISLDSRSLLFIVKSLCNGGHLDKASEFIHAVREDDRIS
PLLPIYNFFLGACARTRSVYHASKCLELMDQRRVGKNGITYVALLKLAVFQRNLSTVNDIWKHYVNHYNLDILSLRRFIW
SFTRLGDLKSAYELLQHMVYLALRGEFFVKSNRGKLHSTRLYIPVPSKDETGSEKFAFGVTDRIVDCNSSSKVALPKGHN
KILAIRVLRWSFNDVIHACGQSKNSELAEQLMLQMQNLGLLPSSHTYDGFIRAVAFPEGYEYGMTLLKVMQQQNLKPYDS
TLATVAAYCSKALQVDLAEHLLDQISECSYSYPFNNLLAAYDSLDQPERAVRVLARMKELKLRPDMRTYELLFSLFGNVN
APYEEGNMLSQVDCCKRINAIEMDMMRNGFQHSPISRLNVLRALGAEGMVNEMIRHLQKAENLSAHSNMYLGTPTYNIVL
HSLLEANETDMVINIFKRMKSCGCPADVATYNIMIDCCSLIHSYKSACALVSMMIRDGFSPKAVTFTALMKILLNDANFE
EALNLLDQAALEEIHLDVLSYNTILRKAFEKGMIDVIEYIVEQMHREKVNPDPTTCHYVFSCYVEKGYHATAIEALNVLS
LRMLNEEDKESLQDKKIELEENFVMSEDPEAETKIIELFRKSEEHLAAALLNLRWCAMLGGRIIWSEDQSPWARALSNKY
G*

DNA
ATGTACAGAGCTCTATGGCTTTCTCCATTGCGATTTATTGTGAGCTCGTCGTCGTCAAAGTTAACGCCTTACGTATCTCG
AGGACGAGGACTAAGTGGAATTGATAATGGGGCTGGTTGTTCTTGTTCTCGTAGTGTCACGACAATGATTGGTAATGAAT
TCATTCGATGCCAAGATGAGTCAAAGATCTTACAGTTGCAGATTGTTGATGCCCTTCGTTCAGGAGAGAGGCAAGGAGCG
TCAGCATTGCTTTTTAAGTTAATACAGGGGAATTATTCACTTAGTGCTGATGATTTTCATGATATTCTATATTATTGTGC
TCGATCACCGGATCCTGTGACTTACAGTGTAATGTGCAAGAAGGAAATTAGTCTGGACAGCAGATCTTTGTTGTTCATAG
TAAAATCCCTTTGTAATGGGGGACACTTAGATAAGGCATCAGAGTTTATTCACGCTGTCAGAGAAGATGATCGTATATCT
CCTCTTCTGCCTATCTATAACTTTTTTCTTGGAGCCTGTGCACGAACGAGAAGCGTATATCACGCTAGTAAATGTTTGGA
ATTGATGGATCAACGGAGAGTGGGGAAGAATGGAATAACTTATGTAGCACTTCTCAAGCTTGCAGTTTTTCAGCGCAATC
TATCAACTGTCAATGATATCTGGAAACACTATGTCAACCACTATAACCTGGATATACTTTCTCTCAGAAGATTCATATGG
TCCTTTACAAGGCTAGGGGATTTGAAATCAGCATATGAATTATTGCAACACATGGTGTATCTAGCTTTAAGAGGAGAGTT
CTTTGTTAAATCCAACAGAGGAAAATTGCATTCCACGAGACTGTATATTCCTGTACCATCAAAAGATGAAACAGGATCAG
AGAAATTTGCTTTTGGAGTAACTGATCGCATTGTGGACTGCAATTCGTCTTCAAAAGTGGCTTTGCCGAAAGGTCACAAT
AAAATCCTTGCTATTAGGGTCCTCAGGTGGTCGTTCAATGATGTGATTCATGCATGTGGACAATCTAAAAACTCTGAGCT
AGCGGAGCAGCTAATGCTTCAGATGCAAAATCTTGGGTTGCTACCATCAAGTCACACATATGATGGTTTCATTAGAGCTG
TTGCATTTCCAGAAGGATATGAATATGGCATGACACTGTTGAAAGTAATGCAGCAGCAGAATCTGAAACCATATGATTCA
ACTCTAGCTACGGTTGCAGCCTATTGCAGTAAAGCCCTTCAAGTTGATTTAGCTGAACATCTGCTGGATCAAATATCTGA
ATGCTCATACTCATATCCTTTCAATAACCTTCTTGCTGCATATGACTCCTTGGATCAACCAGAGCGTGCTGTCCGAGTTT
TGGCTAGAATGAAAGAGCTAAAACTGCGTCCAGATATGAGGACCTATGAACTGCTCTTTTCCTTATTTGGTAATGTAAAT
GCACCATATGAAGAGGGCAACATGTTGTCCCAAGTAGACTGTTGTAAAAGGATTAACGCTATAGAAATGGACATGATGAG
AAATGGTTTTCAGCACAGTCCTATCTCAAGGCTGAATGTGCTTAGAGCTCTCGGAGCTGAAGGTATGGTGAATGAGATGA
TCCGACACCTGCAAAAGGCTGAGAACCTCAGTGCTCACAGCAATATGTATCTAGGAACGCCTACATACAACATAGTGCTT
CATTCACTTCTCGAGGCAAACGAAACTGACATGGTGATCAATATATTCAAACGTATGAAATCATGTGGCTGCCCTGCAGA
CGTTGCTACCTACAATATAATGATTGATTGTTGCAGCCTTATTCACTCGTATAAATCAGCTTGTGCCCTAGTTTCCATGA
TGATCCGTGACGGGTTTTCTCCAAAAGCTGTTACATTTACTGCTCTGATGAAGATTTTGTTGAATGATGCGAATTTCGAG
GAGGCACTCAATCTCTTGGACCAAGCGGCATTAGAAGAGATACATCTTGATGTCTTATCATACAACACCATTTTGCGTAA
AGCGTTTGAGAAGGGAATGATTGATGTGATTGAGTACATAGTGGAGCAAATGCACCGAGAGAAAGTGAATCCAGATCCAA
CGACATGTCATTATGTTTTCAGTTGTTATGTGGAGAAAGGGTATCATGCAACAGCTATAGAAGCTTTGAATGTTCTGAGC
TTAAGGATGCTCAACGAAGAAGACAAGGAGAGTCTTCAGGACAAGAAAATAGAGCTAGAGGAAAATTTCGTCATGAGCGA
AGACCCTGAAGCTGAAACAAAGATAATCGAACTGTTCAGAAAATCTGAGGAGCATCTTGCTGCAGCACTTCTGAATCTAA
GATGGTGTGCAATGCTCGGGGGCCGGATAATATGGTCGGAAGACCAAAGCCCCTGGGCCAGAGCACTCTCCAACAAGTAC
GGTTAA