Details for Arabidopsis Locus AT1G76260

Position : Chr1 ( 5`- 28610265 .. 28613263 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76260

Protein [Map View]
MQGGSSGIGYGLKYQARCISDVKADRDHTSFLTGTLSLKEENEVHLLRLSSGGSELLCEGLFSHPNEIWDLASSPFDQRI
FSTVFSTGDSYGAAIWQIPEPYGQSNSSTLECVASLDAHVGKINCVLWCPSGNSDKLISMDEQNLVFWSLDSSKKSAEVL
SKESAGMRHSLSGGAWNPHDVNSVAATSESSIQFWDLRTMKKNNSIERAHVRNVDYNLKREHILVSADDESGIHLWDLRK
TKFPVQELPGHTHWTWAVRCNPEYEELILSVGTDSAVNLWFASASSEHKTSESPVEASRQRVNPLLNSYTDYEDSVYGLA
WSSREPWIFASLSYDGRVVIESVKPFLPRR*

DNA
ATGCAAGGAGGATCATCGGGTATTGGTTATGGTTTGAAGTATCAGGCCAGATGTATATCGGATGTTAAAGCAGATAGAGA
TCACACTAGCTTCCTCACTGGAACCCTAAGCTTGAAAGAAGAAAATGAGGTTCATTTGCTTCGTTTGTCTTCTGGTGGAT
CTGAGCTGTTATGTGAGGGATTGTTCTCGCATCCTAATGAAATTTGGGACCTTGCTTCTTCCCCTTTTGATCAACGCATT
TTCTCTACTGTCTTCTCCACTGGCGACTCATATGGAGCAGCAATATGGCAGATTCCTGAGCCATATGGTCAATCGAATTC
TTCAACATTGGAATGTGTTGCTTCCCTTGATGCACATGTTGGTAAGATTAATTGCGTTCTTTGGTGTCCCTCTGGAAATT
CTGACAAGTTAATCAGCATGGATGAACAAAATCTTGTCTTCTGGAGTTTAGACTCTTCAAAGAAAAGTGCGGAGGTTTTA
TCTAAGGAGTCAGCTGGTATGCGTCATTCTTTATCTGGTGGAGCATGGAATCCACATGATGTGAATTCTGTTGCAGCAAC
TTCTGAATCATCTATCCAGTTTTGGGACTTACGTACTATGAAGAAGAATAATTCAATTGAACGTGCCCATGTACGTAATG
TTGACTACAATCTCAAGAGAGAACATATACTCGTTTCTGCGGATGATGAATCTGGTATACATCTCTGGGATCTTCGGAAG
ACAAAGTTTCCTGTGCAAGAGCTCCCTGGTCATACACACTGGACATGGGCTGTCAGGTGTAACCCTGAGTATGAAGAGCT
AATTCTGAGCGTTGGAACAGACTCAGCTGTCAACTTGTGGTTTGCTTCAGCATCTAGTGAGCATAAAACATCAGAAAGCC
CGGTGGAAGCATCACGTCAGCGTGTGAACCCGTTACTAAACTCTTATACTGACTACGAAGACAGTGTCTACGGCCTTGCT
TGGAGCTCGCGTGAGCCTTGGATTTTTGCATCATTGTCATATGACGGTAGGGTTGTGATCGAATCCGTCAAGCCTTTCCT
GCCAAGAAGATAG