Details for Arabidopsis Locus AT1G76220

Position : Chr1 ( 5`- 28597530 .. 28598300 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76220

Protein [Map View]
MACTSSSGAHVRSTSWSEDVNPLSRAIEDHLLLLKKRPESARRKLGVLKNLYEVVEVFLRFQTTKTQKSFTGFEDVSDGF
IEVLDICSTIRDVLMEIKEQVRELESSLRRRLIRSKSGEDQEAFVARETDAYVFKRRALSRTIVKQLKKTEEKMRKRKRD
CGDVINVMKRVEKTSFDVLVSLLIEVVTKDQRDQKKGSRRGIVSRIFNKKNQEVDVDELKKLRETEHEIEETEKELECVY
KKLLKTRVSFLNMLTL*

DNA
ATGGCTTGTACTTCATCATCTGGTGCACACGTGCGTTCAACAAGCTGGTCCGAAGACGTTAATCCTCTGTCTCGAGCCAT
CGAAGATCATCTTCTGTTACTAAAGAAAAGACCAGAGTCCGCTCGTCGGAAACTTGGAGTTTTAAAGAATCTGTACGAGG
TTGTCGAAGTTTTCCTCCGTTTTCAAACGACTAAAACTCAAAAGTCTTTCACAGGATTTGAAGATGTTTCTGACGGATTC
ATCGAGGTTCTTGATATCTGCAGCACGATCAGAGACGTTCTGATGGAGATAAAGGAACAAGTCAGGGAACTCGAATCAAG
CTTGAGGAGGAGATTGATCAGAAGCAAGTCAGGAGAAGATCAAGAAGCTTTCGTGGCGCGTGAGACAGACGCGTACGTGT
TTAAGAGAAGAGCACTGAGCAGAACCATCGTCAAACAATTGAAGAAAACAGAGGAGAAGATGAGGAAGAGGAAGAGAGAT
TGTGGAGATGTCATTAATGTAATGAAAAGAGTTGAAAAGACCAGCTTTGATGTTTTGGTTTCTTTGTTGATTGAGGTAGT
GACGAAGGATCAGAGAGATCAAAAGAAAGGATCAAGGAGAGGAATTGTGTCGAGGATTTTTAATAAGAAGAATCAAGAAG
TTGATGTGGATGAGCTGAAGAAGTTGAGAGAAACAGAACATGAGATTGAAGAAACAGAGAAAGAGTTGGAGTGTGTGTAT
AAGAAACTGTTGAAGACAAGAGTTTCTTTTCTTAACATGCTTACTCTTTGA