Details for Arabidopsis Locus AT1G76200

Position : Chr1 ( 5`- 28593250 .. 28594742 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76200

Protein [Map View]
MGGGGHGGGITYKGVTVHTPKTWHTVTGKGLCAVMWFWILYRAKQDGPVVMGWRHPWDGHGDHGHGDHH*

DNA
ATGGGTGGAGGAGGACATGGCGGAGGTATAACTTACAAGGGAGTCACTGTCCACACTCCCAAGACTTGGCACACCGTCAC
CGGAAAAGGCTTGTGCGCCGTTATGTGGTTCTGGATTCTGTACAGGGCAAAGCAAGATGGTCCTGTAGTTATGGGATGGA
GGCACCCTTGGGATGGTCATGGTGATCACGGTCACGGAGATCATCACTAG