Details for Arabidopsis Locus AT1G76170

Position : Chr1 ( 5`- 28584039 .. 28586225 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76170

Protein [Map View]
MEAGEEKSKKAGGECFYEVFEEEIHQVIVGNRLFKFGERVAIGASGGKDSSVLAYVLSELNRRHSYGLDLFLLSIDEGIT
GYRDDSLETVKRNEVQYGLPLQIVSYKDLYGWTMDEIVKMIGLKNNCTFCGVFRRQALDRGAALLKVDKLVTGHNADDIA
ETVVLNILRGDIARLSRCTSITTGEDGPIPRCKPFKYTYEKEIVMYAYFKKLDYFSTECIYSPNAYRGFACEFINDLERL
RPRAILDIIKSGEDFRIATTTKMPEQGTCERCGYISSQKWCKACVLLEGLNRGLPKMGIGRPRGNVNGDYKDIKARSTAK
TIESKQCGSLDF*

DNA
ATGGAGGCAGGGGAAGAGAAGAGCAAGAAAGCAGGAGGAGAGTGTTTCTATGAGGTTTTTGAGGAAGAGATTCACCAAGT
CATTGTTGGGAATCGTTTGTTTAAGTTCGGTGAACGAGTTGCTATAGGTGCCTCCGGTGGAAAAGATTCTTCAGTGCTGG
CATATGTGTTATCAGAACTAAACAGACGTCACAGTTACGGACTCGATCTTTTTCTTTTGTCTATTGATGAAGGGATAACG
GGTTATCGTGATGATTCTCTCGAGACTGTTAAAAGGAACGAAGTTCAATATGGATTGCCTCTTCAGATTGTTTCATACAA
AGATCTGTATGGATGGACAATGGACGAGATTGTGAAGATGATCGGTTTGAAGAACAATTGCACCTTCTGTGGTGTATTCC
GTCGACAGGCACTTGATCGAGGAGCTGCGTTATTGAAAGTAGATAAGCTAGTCACTGGACATAATGCAGATGATATAGCC
GAAACAGTTGTCTTAAACATACTGCGAGGCGATATTGCTAGATTGAGTAGGTGCACATCAATCACTACAGGCGAAGATGG
TCCAATTCCAAGATGTAAACCTTTCAAATATACATACGAGAAGGAGATTGTCATGTATGCTTATTTCAAGAAGCTGGACT
ACTTCTCCACTGAATGCATATACTCCCCTAATGCTTATCGTGGATTCGCCTGTGAGTTCATCAATGACTTGGAAAGACTA
AGGCCAAGGGCTATTCTGGATATCATCAAGTCAGGTGAAGACTTCAGAATTGCCACAACCACGAAAATGCCTGAGCAAGG
GACTTGTGAGCGATGTGGGTATATTTCTAGCCAGAAATGGTGCAAAGCTTGTGTTTTGTTGGAAGGATTGAACCGTGGTC
TGCCTAAGATGGGCATTGGAAGACCAAGAGGAAACGTAAATGGTGATTATAAGGACATAAAGGCTAGATCTACTGCAAAA
ACTATAGAGAGCAAACAATGTGGATCTCTGGATTTCTAA