Details for Arabidopsis Locus AT1G76130

Position : Chr1 ( 5`- 28561281 .. 28564076 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76130

Protein [Map View]
MGYYNNVFDECNDQTDIGRVIRDGREVILQAYNWESHKYDWWRNLDGKVPDIAKSGFTSAWLPPPSQSLAPEGYLPQDLY
SLNSAYGSEHLLKSLLRKMKQYKVRAMADIVINHRVGTTRGHGGMYNRYDGISLPWDEHAVTSCTGGLGNRSTGDNFNGV
PNVDHTQHFVRKDIIGWLRWLRNTVGFQDFRFDFARGYSANYVKEYIGAAKPLFSVGECWDSCNYNGHGLDYNQDSHRQR
IISWIDATGQISAAFDFTTKGILQEAVKGQYWRLCDAQGKPPGVMGWWPSRAVTFLDNHDTGSTQAHWPFPSHHVMEGYA
YILTHPGIPCVFYDHFYDWGSSIHDQIVKLIDIRRRQDIHSRSTVRVLKAESNLYAAIVGEKICMKLGDGSWCPSGRDWT
LATSGHRYAVWHK*

DNA
ATGGGCTACTATAACAATGTCTTTGATGAATGCAACGACCAAACTGATATCGGTCGGGTTATACGCGATGGAAGGGAAGT
CATTCTCCAAGCATATAATTGGGAATCTCATAAATATGATTGGTGGAGAAACTTGGATGGTAAAGTTCCTGACATCGCGA
AATCCGGCTTTACTTCTGCATGGTTGCCACCACCATCTCAGTCTCTTGCACCGGAAGGTTATCTTCCACAGGACCTTTAT
TCACTAAACTCAGCATATGGCTCTGAGCATCTATTGAAATCCTTACTGCGCAAGATGAAACAATACAAAGTTAGAGCTAT
GGCTGATATAGTCATCAATCATCGTGTTGGGACAACTAGAGGACATGGTGGAATGTATAACCGTTATGATGGAATTTCAT
TACCGTGGGATGAACACGCCGTGACTTCTTGTACCGGAGGACTGGGTAACCGAAGCACAGGGGATAATTTCAATGGAGTT
CCAAATGTTGATCACACTCAGCATTTTGTTAGGAAAGATATAATTGGATGGCTTCGTTGGTTACGCAACACCGTCGGGTT
TCAAGATTTCCGTTTTGACTTTGCTAGGGGTTATTCAGCAAACTATGTGAAGGAATACATTGGCGCAGCGAAACCATTAT
TCTCGGTTGGAGAATGTTGGGATTCTTGCAATTACAATGGCCATGGTCTAGACTATAATCAAGATAGCCATAGACAGCGT
ATAATCAGTTGGATCGATGCGACGGGACAGATCTCTGCTGCATTTGACTTCACAACTAAAGGAATTCTGCAGGAAGCCGT
AAAGGGTCAGTATTGGCGTTTATGTGATGCCCAAGGGAAGCCACCGGGTGTAATGGGATGGTGGCCTTCAAGAGCTGTCA
CATTCCTTGATAACCATGACACTGGCTCTACTCAGGCTCATTGGCCGTTCCCTTCACACCACGTTATGGAGGGCTATGCA
TATATACTTACTCATCCCGGCATTCCCTGTGTGTTCTACGATCACTTTTACGATTGGGGAAGCTCAATACATGATCAGAT
TGTCAAACTGATTGACATTAGGAGGCGACAAGATATCCACAGTAGGTCAACTGTCCGTGTTTTAAAAGCAGAATCTAACT
TATATGCAGCCATTGTTGGTGAGAAAATATGTATGAAGCTTGGAGACGGCTCTTGGTGCCCTTCTGGTAGAGACTGGACT
CTAGCAACAAGTGGCCATCGCTATGCCGTCTGGCACAAGTAA