Details for Arabidopsis Locus AT1G76110

Position : Chr1 ( 5`- 28555042 .. 28557586 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76110

Protein [Map View]
MSSDNESTPSQATVEMMATSPAKIKEYPEPLALHEVVVKDSSVFWDTLRRFHSIMSTKFMIPVIGGKELDLHVLYVEVTR
RGGYEKVVVEKKWREVGGVFRFSATTTSASFVLRKHYLNLLFHYEQVHLFTARGPLLHPIATFHANPSTSKEMALVEYTP
PSIRYHNTHPPSQGSSSFTAIGTIEGKFDCGYLVKVKLGSEILNGVLYHSAQPGPSSSPTAVLNNAVVPYVETGRRRRRL
GKRRRSRRREDPNYPKPNRSGYNFFFAEKHCKLKSLYPNKEREFTKLIGESWSNLSTEERMVYQDIGLKDKERYQRELNE
YRETLRLRDGDMTNGKAF*

DNA
ATGTCATCGGACAACGAATCGACACCGTCTCAAGCGACGGTAGAAATGATGGCGACTTCGCCGGCGAAGATTAAAGAGTA
TCCAGAACCATTGGCTTTACATGAAGTTGTCGTCAAGGATTCTTCTGTCTTCTGGGATACTCTCAGGCGGTTTCACTCAA
TTATGTCCACTAAGTTCATGATTCCTGTGATTGGAGGAAAAGAACTAGATTTGCATGTTTTGTATGTGGAAGTCACGAGG
AGGGGAGGTTACGAAAAGGTAGTCGTAGAGAAAAAATGGAGGGAAGTTGGAGGAGTGTTTAGATTCTCTGCGACAACAAC
AAGTGCTTCGTTTGTCTTAAGGAAACATTATCTCAATCTTCTCTTCCATTACGAACAAGTTCATCTCTTCACTGCTCGTG
GTCCTCTTCTTCATCCCATAGCTACATTTCATGCAAATCCCTCAACGAGCAAAGAAATGGCGCTCGTCGAATATACTCCT
CCGAGTATAAGATATCATAATACTCATCCTCCTTCTCAAGGTTCGTCGAGTTTCACAGCCATAGGTACAATAGAAGGCAA
ATTCGATTGTGGTTATCTGGTAAAAGTTAAGTTGGGCTCAGAGATTCTTAACGGCGTTCTTTATCATTCGGCCCAGCCCG
GCCCATCATCATCTCCAACCGCTGTTCTAAACAATGCCGTTGTACCTTATGTTGAAACTGGGAGGAGACGGCGTCGTTTA
GGTAAAAGACGAAGAAGCAGACGCAGAGAAGATCCGAATTACCCGAAACCGAACCGGAGCGGTTACAATTTCTTCTTTGC
TGAGAAACATTGCAAGCTCAAATCACTTTATCCCAACAAGGAGAGAGAGTTTACGAAACTTATCGGAGAATCGTGGAGCA
ATCTCTCTACCGAAGAACGAATGGTTTATCAAGACATTGGATTGAAGGATAAGGAAAGGTATCAGAGGGAGTTGAATGAG
TACAGAGAAACGTTGAGACTTAGGGATGGTGACATGACAAACGGCAAGGCTTTTTAG