Details for Arabidopsis Locus AT1G76100

Position : Chr1 ( 5`- 28553987 .. 28554768 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76100

Protein [Map View]
MAAITSATVTIPSFTGLKLAVSSKPKTLSTISRSTSATRAPPKLALKSSLKDFGVIAVATAASIVLAGNAMAMEVLLGSD
DGSLAFVPSEFTVAKGEKIVFKNNAGFPHNVVFDEDEIPSGVDASKISMDETALLNGAGETYEVTLTEPGSYGFYCAPHQ
GAGMVGKLTVK*

DNA
ATGGCCGCAATTACATCAGCTACCGTCACCATCCCTTCTTTCACCGGCCTAAAGCTCGCCGTCAGCTCAAAACCTAAGAC
ATTATCCACCATCAGTAGATCCACTTCCGCCACCAGGGCGCCACCTAAGCTCGCTTTGAAGTCCTCTTTGAAGGATTTCG
GTGTCATCGCAGTGGCAACAGCAGCTTCGATCGTTTTAGCTGGAAATGCGATGGCCATGGAGGTTCTTTTAGGATCCGAC
GACGGTTCCCTTGCTTTCGTACCATCTGAATTCACGGTGGCTAAAGGAGAGAAGATCGTGTTCAAGAACAACGCAGGGTT
CCCACATAACGTGGTGTTCGACGAAGACGAGATCCCTAGTGGTGTGGACGCAAGCAAGATCTCGATGGATGAGACAGCGC
TTCTAAATGGTGCAGGGGAGACTTACGAGGTTACTTTGACAGAGCCAGGCTCTTACGGTTTCTATTGTGCGCCGCACCAG
GGTGCTGGTATGGTTGGGAAACTCACCGTCAAGTAA