Details for Arabidopsis Locus AT1G76080

Position : Chr1 ( 5`- 28547786 .. 28549419 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76080

Protein [Map View]
MATVANFLAKPISTVVPRPSSAVASTSSFVFFNHKTNPLFRRKNLPKRLFSAVKIKAGAASPGKVGTPPANDEKVQKIHS
GEEFDVALKNAKSKLVVAEFATSKSDQSNKIYPFMVELSRTCNDVVFLLVMGDESDKTRELCRREKIEKVPHFSFYKSME
KIHEEEGIEPDQLMGDVLYYGDNHSAVVQLHGRPDVEKLIDENRTGGKLIVLDVGLKHCGPCVKVYPTVLKLSRSMSETV
VFARMNGDENDSCMEFLKDMNVIEVPTFLFIRDGEIRGRYVGSGKGELIGEILRYSGVRVTY*

DNA
ATGGCCACCGTCGCTAACTTCTTAGCCAAACCAATCTCCACCGTAGTCCCACGGCCATCCTCCGCCGTTGCTTCGACCTC
CTCCTTCGTATTCTTTAACCATAAAACTAATCCTCTGTTCCGGAGGAAAAACCTCCCGAAAAGATTATTCTCCGCCGTGA
AAATAAAGGCTGGAGCGGCGTCTCCGGGAAAGGTGGGTACACCACCGGCGAATGACGAGAAGGTACAAAAGATTCACAGC
GGAGAGGAATTCGACGTAGCGTTGAAAAATGCGAAGAGCAAACTCGTGGTTGCAGAGTTTGCTACGAGTAAGAGTGATCA
GAGTAATAAGATATATCCGTTTATGGTGGAACTGAGCAGGACCTGTAACGACGTCGTTTTCTTGCTCGTCATGGGTGATG
AATCTGACAAGACCAGAGAACTCTGTCGGAGAGAGAAGATTGAGAAAGTTCCTCACTTTAGCTTTTATAAGAGCATGGAG
AAAATACACGAGGAAGAAGGTATTGAACCGGACCAGTTAATGGGAGACGTTCTATACTACGGAGACAACCACTCTGCGGT
GGTGCAGCTGCACGGCCGACCTGACGTGGAAAAGCTGATCGACGAGAATCGCACTGGAGGCAAGCTGATCGTGCTTGACG
TTGGTCTAAAACATTGTGGTCCTTGCGTTAAAGTGTATCCGACCGTGCTGAAACTGTCCCGGTCAATGTCCGAGACAGTC
GTATTCGCTAGAATGAACGGTGACGAGAACGATAGTTGTATGGAGTTTCTCAAGGACATGAATGTTATCGAAGTTCCAAC
TTTCTTGTTCATTAGAGACGGCGAGATTCGTGGCCGTTATGTTGGTTCCGGTAAAGGAGAACTCATTGGAGAGATTCTTC
GGTACTCAGGCGTTCGTGTCACTTATTAA