Details for Arabidopsis Locus AT1G76050

Position : Chr1 ( 5`- 28540823 .. 28543227 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76050

Protein [Map View]
MLSISQLPSFSLTTAKSLRYPSSPSSSLSIFFSFFPKVSNFVRASSGIPNLVACSPTEIIIPRVNNAGLRIEEIVDAAKG
KIRLDSWISSRINGVSRARVQSSIRLGLVTVNGRVVDKVSHNVKSGDEVNCTISELQPLKAEAEDIPLDIVYEDKHVLVV
NKPAHMVVHPAPGNPTGTLVNGILHHCSLPCVDYSNSEEDDDSDEETFSDDEEMTTSPSSYAASVRPGIVHRLDKGTTGL
LVVAKDEHSHAHLAEQFKLHTIERVYVSLTTGVPSPPQGRIEIPIGRDSSNRIRMAAIPGGVRGGRARHAASRYKVIETF
AGGGSALVEWRLETGRTHQIRAHAKYMGVPLLGDEVYGGTKSMALSLLQKRVSRSDQEEIIELISRMDRPCLHAIVLGFT
HPCTGEIVKFSCPPPSDLAEIVGLLRRSGL*

DNA
ATGCTCTCAATCTCGCAGCTGCCGAGTTTCTCGTTAACCACCGCCAAATCTCTTCGTTATCCTTCTTCTCCTTCGTCGTC
TCTCTCTATCTTCTTCTCCTTCTTCCCTAAGGTTTCTAATTTCGTCAGAGCAAGTTCCGGAATCCCCAATTTGGTCGCCT
GTAGTCCGACAGAGATTATCATCCCCAGAGTTAATAACGCCGGACTCAGAATCGAGGAGATAGTAGACGCCGCGAAAGGC
AAAATTCGTCTTGATTCATGGATCTCTTCTCGTATCAATGGCGTTAGCCGAGCTCGTGTACAGTCGAGTATACGATTGGG
ACTCGTTACCGTCAATGGTCGTGTCGTTGATAAGGTTTCACACAATGTCAAATCTGGTGATGAGGTTAATTGTACGATAT
CAGAGCTTCAACCTTTGAAAGCTGAAGCTGAAGATATACCATTAGATATAGTTTATGAAGATAAACATGTTCTTGTTGTT
AACAAACCAGCTCACATGGTCGTTCATCCTGCGCCTGGGAATCCTACCGGCACGCTTGTTAATGGCATACTTCATCATTG
TAGTCTTCCTTGTGTTGATTATTCGAACTCAGAAGAAGATGATGATTCCGATGAAGAAACATTTTCAGATGATGAAGAGA
TGACTACCTCTCCTAGTTCATATGCTGCTTCTGTTCGTCCTGGTATTGTTCATAGGTTGGATAAAGGCACAACTGGATTG
CTCGTTGTAGCCAAGGATGAACATTCTCATGCCCATTTAGCAGAACAGTTCAAGCTACACACAATTGAGAGAGTATATGT
AAGTCTTACTACTGGGGTTCCTTCTCCACCACAGGGGCGTATTGAGATACCGATTGGTCGTGATTCGAGTAATCGGATAC
GTATGGCTGCTATTCCTGGAGGAGTAAGGGGTGGAAGAGCCCGCCATGCTGCTAGTAGGTATAAGGTAATCGAAACATTC
GCTGGAGGTGGCTCTGCATTGGTTGAGTGGAGACTGGAAACCGGCCGTACTCATCAGATACGTGCTCATGCTAAATATAT
GGGAGTTCCTCTATTGGGTGACGAAGTGTATGGTGGAACAAAAAGCATGGCCCTTTCTCTTTTGCAGAAAAGAGTCTCCC
GCAGCGATCAAGAAGAGATCATAGAGCTTATTTCCAGAATGGATAGACCTTGCCTTCATGCTATAGTTCTCGGCTTTACA
CATCCGTGCACTGGGGAAATAGTAAAGTTTTCATGTCCACCGCCTTCAGATCTTGCTGAGATAGTAGGCTTGCTTCGTAG
AAGCGGATTATAA