Details for Arabidopsis Locus AT1G76030

Position : Chr1 ( 5`- 28533798 .. 28537194 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT1G76030

Protein [Map View]
MGTNDLDIEEGTLEIGMEYRTVSGVAGPLVILDKVKGPKYQEIVNIRLGDGSTRRGQVLEVDGEKAVVQVFEGTSGIDNK
FTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQK
IPLFSAAGLPHNEIAAQICRQAGLVKRLEKTVDLLEDHGEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNLA
NDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLATIYERAGRIEGR
KGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHSDVSNQLYA
NYAIGKDVQAMKAVVGEEALSSEDLLYLEFLDKFERKFVMQGAYDTRNIFQSLDLAWTLLRIFPRELLHRIPAKTLDQFY
SRDSTS*

DNA
ATGGGGACGAATGATCTCGACATCGAAGAAGGGACTCTGGAGATCGGCATGGAGTATAGAACTGTTTCTGGTGTTGCTGG
ACCATTGGTCATTCTTGACAAAGTGAAGGGTCCAAAGTACCAGGAGATTGTTAATATTCGCTTAGGAGATGGATCAACGA
GACGTGGTCAGGTTTTGGAAGTTGATGGCGAGAAAGCAGTTGTGCAGGTTTTTGAAGGAACATCTGGAATTGACAACAAG
TTTACAACCGTGCAATTCACAGGAGAGGTTTTGAAAACACCTGTATCATTGGACATGCTTGGGCGCATATTTAACGGTTC
AGGAAAGCCGATTGATAATGGCCCTCCTATTCTGCCAGAAGCATACCTTGATATTTCAGGAAGTTCAATCAACCCCAGTG
AAAGAACCTATCCTGAAGAGATGATACAGACAGGCATATCGACCATCGATGTCATGAATTCCATTGCTCGTGGACAGAAG
ATTCCACTTTTCTCTGCTGCTGGTCTTCCACATAATGAAATAGCTGCTCAGATTTGTCGTCAGGCTGGTCTAGTCAAGCG
TTTGGAAAAGACTGTTGATCTACTTGAGGATCATGGAGAGGACAATTTTGCAATTGTGTTTGCAGCTATGGGTGTGAACA
TGGAGACAGCTCAGTTCTTCAAGCGAGATTTTGAAGAAAATGGATCAATGGAGAGAGTTACTCTTTTCCTGAACCTGGCC
AATGACCCAACCATTGAGAGAATCATCACTCCTCGAATTGCCCTCACAACAGCTGAATATCTGGCTTATGAATGTGGGAA
ACACGTCCTTGTTATATTGACGGATATGAGTTCTTATGCTGATGCTCTTCGTGAGGTTTCCGCTGCCCGAGAAGAGGTTC
CCGGAAGACGTGGATATCCAGGTTATATGTACACTGATCTTGCAACTATTTATGAACGTGCTGGGCGTATAGAAGGAAGA
AAAGGTTCCATCACCCAAATTCCAATCCTCACTATGCCCAATGACGATATCACTCATCCAACTCCGGATCTTACTGGTTA
CATTACTGAAGGTCAGATATATATCGATAGGCAACTTCACAACAGACAGATATATCCACCCATCAACGTGCTTCCATCCC
TTTCTCGTTTAATGAAGAGTGCTATCGGCGAGGGCATGACTCGTAAAGACCATTCTGATGTGTCGAACCAGCTGTATGCA
AATTATGCAATCGGGAAAGATGTTCAAGCGATGAAAGCTGTTGTTGGAGAAGAAGCACTTTCTTCAGAGGATTTGCTTTA
TCTAGAGTTTTTGGATAAGTTTGAGAGGAAGTTTGTGATGCAAGGAGCTTATGATACACGCAACATCTTCCAGTCGCTGG
ACTTAGCTTGGACATTGCTCCGTATCTTCCCACGGGAGCTTCTTCATCGTATCCCTGCAAAGACACTTGACCAATTCTAC
AGCCGCGACTCAACCAGTTAA